CAZyme Information: PPTG_08286-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_08286-t26_1-p1
• CAZy Family: GH17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
337	KI669575|CGC2	37538.70	8.0584

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669575:1008192-1009205(-)

Full Sequence      

MLRRAALRAAQVSAVSKTRTFATSQLHTAAKKKQPSAIVLAAAGVAAVSGFALTDLVNAR
EKPVDLDAIKKEIIEIFDEDNYMGPTMVRLAWHSSGSYSAKDNSGGSTGGTIRFDPEINH
GGNAGLHLAVKALEKVKKNHPEITYADLYILAGVTMIEEMGGPEIPFRLGRPDAKSGKEP
TQTPDDRLPDADKGSKDKTTQHVREVFYRMGFNDRDIVALVGAHAIGRCYPTRSGYSGPW
TNAEWTFSNEFFRELIENKWTIKKWDGPMQYEDPTGKLMMLPADIVLIQDPEFKKYVELY
AKDEELWFKDFSKAFVKLTENGVKFPKSGWFSFFSSN

Enzyme Prediction     

No EC number prediction in PPTG_08286-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	69	322	7e-59	0.9607843137254902

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173825	ascorbate_peroxidase	4.21e-149	57	326	4	253	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.
178218	PLN02608	9.72e-81	85	329	32	250	L-ascorbate peroxidase
166005	PLN02364	4.57e-63	84	322	33	246	L-ascorbate peroxidase 1
178467	PLN02879	2.99e-62	80	322	30	246	L-ascorbate peroxidase
173823	plant_peroxidase_like	5.00e-61	67	320	1	255	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ22874.1|AA2	1.01e-202	1	334	1	339
UKZ92149.1|AA2	8.36e-91	58	327	79	340
BDA47129.1|AA2	1.26e-90	67	325	97	348
QKY15243.1|AA2	1.42e-90	62	327	92	366
BCS12828.1|AA2	4.72e-87	67	336	100	363

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AL9_A	8.64e-79	59	324	1	260	Structure of Leishmania major peroxidase D211R mutant (high res) [Leishmania major],5ALA_A Structure of Leishmania major peroxidase D211R mutant (low res) [Leishmania major],5ALA_B Structure of Leishmania major peroxidase D211R mutant (low res) [Leishmania major]
3RIV_A	8.92e-79	58	324	1	261	The Crystal Structure of Leishmania major Peroxidase [Leishmania major strain Friedlin],3RIV_B The Crystal Structure of Leishmania major Peroxidase [Leishmania major strain Friedlin]
4GED_A	1.15e-78	59	324	1	260	Crystal Structure of the Leishmania Major Peroxidase-Cytochrome C Complex [Leishmania major]
5AMM_A	1.22e-78	59	324	1	260	Structure of Leishmania major peroxidase D211N mutant [Leishmania major],5AMM_B Structure of Leishmania major peroxidase D211N mutant [Leishmania major]
3RIW_A	2.87e-77	58	324	1	261	The Crystal Structure of Leishmania major Peroxidase mutant C197T [Leishmania major strain Friedlin],3RIW_B The Crystal Structure of Leishmania major Peroxidase mutant C197T [Leishmania major strain Friedlin]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WPF8|CCPR_ASPFU	1.73e-90	67	325	100	352	Cytochrome c peroxidase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=ccp1 PE=3 SV=1
sp|Q4PBY6|CCPR_USTMA	1.32e-86	77	323	130	368	Cytochrome c peroxidase, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CCP1 PE=3 SV=1
sp|Q7SDV9|CCPR_NEUCR	2.24e-86	65	328	86	347	Cytochrome c peroxidase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=ccp-1 PE=3 SV=1
sp|Q4ING3|CCPR_GIBZE	7.17e-85	68	327	92	343	Cytochrome c peroxidase, mitochondrial OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=CCP1 PE=3 SV=1
sp|A4QVH4|CCPR_MAGO7	4.58e-84	77	327	106	348	Cytochrome c peroxidase, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=CCP1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999907	0.000131

TMHMM  Annotations     

There is no transmembrane helices in PPTG_08286-t26_1-p1.