CAZyme Information: PPTG_08020-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_08020-t26_1-p1
• CAZy Family: GH16|GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
348	KI669575|CGC1	37960.63	5.3559

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669575:129694-130740(+)

Full Sequence      

MHTFALPLVTLAALVSIVGAQVSTACSGPYARTVPPPGAIVVDITGAYNDSYQTMAEGML
YLPNTTEEHTIFIFPGVYQEQVVIPRLAGPLVVQGYTCDTTSYTENKVTITHTMAQKDLA
PEIKNSRNDLVSTLRLKSSSGVKMYNVNVANPTGKIDNLGQAVAVYVDAPNYGFYGCNFT
GYQDTLCAHKGRELYARSYISGAVDFIFGMRAKAWFESCDFETIGKGWITANGNQNSSNL
SEYVFNRARIFGKSGNGSTYLGRPWYPYARVVWQNSELSDVVNPAGWATWDSVTSTANVT
FKEFNNSGPGAATDKRVSFSGQLNASVPITALMGEGYESEWWVDTAFL

Enzyme Prediction     

EC	3.1.1.11:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	49	325	1.3e-69	0.9201388888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178372	PLN02773	4.24e-42	62	323	29	282	pectinesterase
178113	PLN02497	4.29e-42	40	326	34	309	probable pectinesterase
178051	PLN02432	3.64e-41	39	325	10	274	putative pectinesterase
395871	Pectinesterase	1.90e-40	147	321	97	276	Pectinesterase.
215357	PLN02665	3.11e-39	146	323	160	340	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACO54874.1|CE8	8.24e-227	6	348	6	348
ACO54872.1|CE8|3.1.1.11	3.40e-196	1	348	1	348
ACO54870.1|CE8	6.00e-192	1	348	1	347
ACO54875.1|CE8	3.68e-167	11	348	7	346
ABQ63096.1|CE8	3.37e-165	1	348	1	344

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	4.94e-62	32	347	3	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	6.97e-62	32	347	3	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	3.11e-32	33	321	4	283	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	5.81e-31	52	332	15	290	Chain A, Pectinesterase 1 [Solanum lycopersicum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12535|PME_ASPAC	1.70e-76	32	347	20	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|P17872|PME_ASPNG	2.40e-76	16	348	4	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q4WBT5|PMEA_ASPFU	4.90e-68	32	347	28	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	4.90e-68	32	347	28	324	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1
sp|A1DBT4|PMEA_NEOFI	1.95e-67	32	347	28	324	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000595	0.999396	CS pos: 20-21. Pr: 0.9073

TMHMM  Annotations     

There is no transmembrane helices in PPTG_08020-t26_1-p1.