CAZyme Information: PPTG_07904-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_07904-t26_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
398		43518.38	7.1435

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669573:816103-817299(+)

Full Sequence      

MKSFLFPFIAAAIAAVTTASNDFLYSTRMIESVISRKQGVVSSGAVTSTLESGVLALAIQ
SWLHTHGQDGDSERVANFTTYADSIVTSISPSFKSPEAAAKMPMDRLTIGQALLHINATE
GTLTTAESDTLSLLNSSLTLQNRNQYHGFWYYVYPNWSYLDGTVSFLPYMATAPGWSYED
MLLQIELLYRNTYDKSTALVVHGYDASKTAVWANKVTGASPYVWGRSLGWYLAGLVNAWE
KLGDCYGGSNAACVRLTKEIQLQASQLCTSIATYADKATGVWWQLPTFGGKKGNFLESSS
TMLYTFSILKGLRLGMLKDKAGKLLNTATKAYDYTVKSGAFLLDYHNGTLGWNGTVAVCS
LNSTATYEYYVGRPIVHNHALGEGAFILASLEMERITN

Enzyme Prediction     

No EC number prediction in PPTG_07904-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	57	395	6.6e-46	0.9427710843373494

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	4.79e-33	142	395	115	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	1.04e-29	141	395	108	341	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26402.1|GH105	5.30e-204	1	395	1	400
UQC88631.1|GH105	6.82e-118	29	395	1	359
QLI72757.1|GH105	2.03e-108	26	397	12	378
QLI74420.1|GH105	2.27e-105	11	396	6	390
QUC20491.1|GH105	4.01e-105	26	396	31	395

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.02e-34	104	396	74	361	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	1.55e-30	142	394	123	365	Structure of Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	3.44e-30	142	394	113	355	Chain A, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O34559|URHG2_BACSU	7.95e-30	142	394	123	365	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	8.17e-20	179	392	20	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	8.17e-20	179	392	20	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.913349	0.086649

TMHMM  Annotations     

There is no transmembrane helices in PPTG_07904-t26_1-p1.