CAZyme Information: PPTG_07507-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_07507-t26_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
299	KI669572|CGC3	31749.36	4.5684

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669572:384419-385318(+)

Full Sequence      

MLVGAVLSAITLLAFAPTADAHGNLKEPPATFEDGAPTVEWVTMIDNYWDIGSGGDQVGK
FKTMAKEKGMSVKDVVLDMVKDKKCGYTRTDVDPKPIPADGKVKWWGNGGGGFTHVGPCE
LYIDDKMVLHGDNCEEDFPGGPDGSEKMSEMPVDFSSCNGKCTLTIYWLGFQNAQWQAYV
NCVPLQGSGSATQTQASTGGSGAEQKTPEAPVKSTTGSRTEEQALEAPSPETQSKKNSSN
GEKTPEAPATQATPAPADENPAEKTPSTEAQTTEVPSSEAQDTKCNAPARRLRKKISVV

Enzyme Prediction     

No EC number prediction in PPTG_07507-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA17	9	266	1.7e-66	0.9755102040816327

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
411474	fibronec_FbpA	1.90e-05	183	289	180	287	LPXTG-anchored fibronectin-binding protein FbpA. FbpA, a fibronectin-binding protein described in Streptococcus pyogenes, has a YSIRK-type (crosswall-targeting) signal peptide and a C-terminal LPXTG motif for covalent attachment to the cell wall. It is unrelated to the PavA-like protein from Streptococcus gordonii (see BlastRule NBR009716) that was given the identical name, so the phase LPXTG-anchored is added to the protein name for clarity.
411474	fibronec_FbpA	5.66e-05	190	280	163	242	LPXTG-anchored fibronectin-binding protein FbpA. FbpA, a fibronectin-binding protein described in Streptococcus pyogenes, has a YSIRK-type (crosswall-targeting) signal peptide and a C-terminal LPXTG motif for covalent attachment to the cell wall. It is unrelated to the PavA-like protein from Streptococcus gordonii (see BlastRule NBR009716) that was given the identical name, so the phase LPXTG-anchored is added to the protein name for clarity.
237030	kgd	2.49e-04	204	293	34	121	multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit.
237555	PRK13914	3.81e-04	187	290	238	335	invasion associated endopeptidase.
236090	PRK07764	4.71e-04	183	280	385	492	DNA polymerase III subunits gamma and tau; Validated

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ETN14458.1|AA17	8.37e-200	1	299	1	299
ETP24148.1|AA17	1.66e-196	1	299	7	305
ETO83080.1|AA17	1.89e-196	1	299	1	299
ETI54333.1|AA17	2.35e-196	1	299	7	305
ETN14460.1|AA17	1.55e-195	1	299	1	299

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Z5Y_A	4.39e-25	22	187	1	172	Chain A, Lytic Polysaccharide Monooxygenase [Phytophthora infestans T30-4],6Z5Y_B Chain B, Lytic Polysaccharide Monooxygenase [Phytophthora infestans T30-4]

Swiss-Prot Hits     

PPTG_07507-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000244	0.999723	CS pos: 21-22. Pr: 0.9776

TMHMM  Annotations     

There is no transmembrane helices in PPTG_07507-t26_1-p1.