CAZyme Information: PPTG_07362-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_07362-t26_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
479		53789.23	4.6403

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669571:1335652-1337091(-)

Full Sequence      

MQRLTSILLLWVACCTAGAASTVGNDVSALHHDGELLEELRVLYPEPNVLYKSPIVFRFQ
IVMPDFSALMAAYTGLRWLCLQLDDTWRRCIPIESGALMIESIEAGNHTARLVMFDSATP
ETGKELLQSYEVAFTVLSDEDFAASLKQQRLDDLALYGPEIRETENMNIVEWFRLQNSEG
GSKTANYVTHEVDPATGDTAAKLPNSSPTNPPLLVIGVKTRVIAGFLFRQAIRQTWASKD
NLPSNVRVLFAACRIPVDASEEVRQAIAHEQKVYGSDLLTDVLDCEDSYASLPQKVKEFL
YFVGTDHVLRRAGYVMIADEDVYVRADVFAEQLAALGPLTDLYAGHVKEGNAFLPERDPQ
RRYYLPESVYPLDEFPPFAWGPHYLMSMDVVDFIAYNREELQGLGCLDDVTIALWLLAIQ
VHPQHLAQFQNLREAPCTNELLAYADLGPPAMRIIHNNLKSGRNFCLGFNRHTWDKDAN

Enzyme Prediction     

EC	2.4.1.122:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT31	229	425	4.1e-36	0.9791666666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
250845	Galactosyl_T	1.34e-23	229	426	3	195	Galactosyltransferase. This family includes the galactosyltransferases UDP-galactose:2-acetamido-2-deoxy-D-glucose3beta-galactosyltransferase and UDP-Gal:beta-GlcNAc beta 1,3-galactosyltranferase. Specific galactosyltransferases transfer galactose to GlcNAc terminal chains in the synthesis of the lacto-series oligosaccharides types 1 and 2.
215596	PLN03133	1.48e-10	189	416	362	579	beta-1,3-galactosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAI32529.1|GT31|2.4.1.122	2.26e-20	186	464	52	323
CAM19511.1|GT31|2.4.1.122	2.26e-20	186	464	52	323
BAA94496.1|GT31	2.26e-20	186	464	52	323
NP_064679.2|GT31|2.4.1.122	2.26e-20	186	464	52	323
AAC53523.1|GT31|2.4.1.122	2.26e-20	186	464	52	323

PDB Hits     

PPTG_07362-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7JK26|B3GT1_PANTR	4.01e-21	186	464	52	323	Beta-1,3-galactosyltransferase 1 OS=Pan troglodytes OX=9598 GN=B3GALT1 PE=3 SV=1
sp|Q7JK24|B3GT1_GORGO	4.01e-21	186	464	52	323	Beta-1,3-galactosyltransferase 1 OS=Gorilla gorilla gorilla OX=9595 GN=B3GALT1 PE=3 SV=1
sp|Q7JK25|B3GT1_PANPA	4.01e-21	186	464	52	323	Beta-1,3-galactosyltransferase 1 OS=Pan paniscus OX=9597 GN=B3GALT1 PE=3 SV=1
sp|O54904|B3GT1_MOUSE	4.01e-21	186	464	52	323	Beta-1,3-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=B3galt1 PE=1 SV=2
sp|Q9MYM7|B3GT1_PONPY	4.01e-21	186	464	52	323	Beta-1,3-galactosyltransferase 1 OS=Pongo pygmaeus OX=9600 GN=B3GALT1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000264	0.999715	CS pos: 19-20. Pr: 0.9787

TMHMM  Annotations     

There is no transmembrane helices in PPTG_07362-t26_1-p1.