CAZyme Information: PPTG_07361-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_07361-t26_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
847	KI669571|CGC1	96572.95	5.9687

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669571:1332624-1335167(-)

Full Sequence      

MDVAIEHDIPGNFSVSAYISANMQAVPSWRSKTVYFSVVSDAEFNTQISDQIREEGKHYP
DFDLSIIEWAKQQQYRQDQELLQRLSQDANEFNSSVDELNGEDLILVVGIKTAVASNFVI
RQAIRQTWASKDTLPAGVKVFFLGCRPFAKIRSDSLDDDEVDRRRLWGAIQLEKLVYGDL
LTDELECDDSYADLPGKVKEFMHFTATKYAQAQYVMVADDDVYVRVDRVVQQLTIKAPTI
RFYSGQVHAIENAQKEKLIRENDGNYRYFLSKEDYPMTNLPPFAIGAYFFLSMDCVEFIS
KNREHLMNMAGMDDMSMALWMLAIQVHAQPFGKLGHLRSGHCTDDLVVLGDLSPLSVRIV
HNNLLQMRRLCHGYNYHFWMKPKNLAPSTGYSRLLDQIETLKFEFSLRDPTAAHGLEITS
TISTDSSAGIKLLYFPALETQLNYHRRMCGAVRLNFPGAASNLSCHVITQLAQDKFQIFY
ENVKNPDFIDLSRMELWRYNLFDTDIHAPPFIVAYTRTASFSSVLLECLFVSVFAEQKRP
LLVMSEQILHRHYRRLPDVFVFSIIDDNCNPVSTPVCQKMIADHFERYVNCSTTFPTTTN
RSTQLVMISGEAWSTDGLDERVLLISTLASANRTKHVYLPMASISFAERLDHGPMPLLSM
SESNRGMEKQKFCAYLYARCDSNRELMFDLLNFLRPVDALGSCAGSSRPPDSAKLASRGA
MFYNDDAVRQYAPYKFVIAFENTRTSGYVTEKLVNAFLAGSVPIYLGDSKTVSQLFNPAS
FIDCGRFDDLQDCAEFVVEVDNSPELYSRMRQERPVTNMTAFYQAFSWHPAVSSRYMADA
VLRHLIR

Enzyme Prediction     

EC	2.4.1.122:14	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT10	590	822	7.7e-38	0.6512968299711815
GT31	121	328	5.2e-34	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395683	Glyco_transf_10	5.55e-18	669	807	1	130	Glycosyltransferase family 10 (fucosyltransferase) C-term. This is the C-terminal domain of a family of fucosyltransferases. This enzyme transfers fucose from GDP-Fucose to GlcNAc in an alpha1,3 linkage. This family is known as glycosyltransferase family 10. The C-terminal domain is the likely binding-region for ADP (manuscript in publication).
250845	Galactosyl_T	3.16e-12	121	327	3	191	Galactosyltransferase. This family includes the galactosyltransferases UDP-galactose:2-acetamido-2-deoxy-D-glucose3beta-galactosyltransferase and UDP-Gal:beta-GlcNAc beta 1,3-galactosyltranferase. Specific galactosyltransferases transfer galactose to GlcNAc terminal chains in the synthesis of the lacto-series oligosaccharides types 1 and 2.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS83483.1|GT10|GT25	4.98e-21	623	813	388	586
AEJ34901.1|GT10	2.01e-20	606	813	14	210
AFX92891.1|GT10|GT25	2.52e-19	569	818	370	601
AGD92741.1|GT10|GT25	2.52e-19	569	818	370	601
AVG46515.1|GT10|GT25	7.34e-19	569	818	354	585

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2NZW_A	7.73e-13	684	828	195	328	Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_C Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZX_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZY_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori]
5ZOI_A	5.69e-12	684	828	195	328	Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],5ZOI_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5UQ63|YR654_MIMIV	1.69e-19	606	813	369	565	Putative fucosyltransferase R654 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_R654 PE=3 SV=1
sp|Q8L7F9|B3GTF_ARATH	1.27e-14	104	371	392	639	Beta-1,3-galactosyltransferase GALT1 OS=Arabidopsis thaliana OX=3702 GN=GALT1 PE=1 SV=1
sp|Q7JK25|B3GT1_PANPA	6.49e-12	106	370	80	324	Beta-1,3-galactosyltransferase 1 OS=Pan paniscus OX=9597 GN=B3GALT1 PE=3 SV=1
sp|Q7JK24|B3GT1_GORGO	6.49e-12	106	370	80	324	Beta-1,3-galactosyltransferase 1 OS=Gorilla gorilla gorilla OX=9595 GN=B3GALT1 PE=3 SV=1
sp|Q7JK26|B3GT1_PANTR	6.49e-12	106	370	80	324	Beta-1,3-galactosyltransferase 1 OS=Pan troglodytes OX=9598 GN=B3GALT1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000088	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PPTG_07361-t26_1-p1.