CAZyme Information: PPTG_06239-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_06239-t26_1-p1
• CAZy Family: GH123
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
351		38431.03	4.9497

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669569:468411-469466(+)

Full Sequence      

MLRVALSFLALVGLASGALPSADTTCSGQNARTVPPPGAIVVDITGTYNGSYQTMAEGMA
YLPNTTEEHTIFVFPGVYQEQVLIPKLAGPLVLQGYTCDTTSYADNKVTITHTMAQRDLP
LEIKNGRNDLVSTVRLKSGSGVKMYNLNVANPTGKIEKLGQAVAVYVDNTNYGFYGCNFT
GYQDTLCAHKGRELYARSYISGAVDFVFGMQAKAWFESCDFETVGKGWITANGNTNSSNL
SEYVFNNARVFNSNASMNGTTYLGRPWYPYARVVWQNSELGDVVNPQGWATWNKNDNNTA
NVYFKEFNNSGPGAAIDQRVPFSGQLNASVKITDLLGADFESEWWVDINFL

Enzyme Prediction     

EC	3.1.1.11:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	49	328	1.8e-72	0.9201388888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178372	PLN02773	1.22e-41	50	326	15	282	pectinesterase
395871	Pectinesterase	2.02e-41	40	324	2	276	Pectinesterase.
178051	PLN02432	5.56e-39	39	328	10	274	putative pectinesterase
178113	PLN02497	1.13e-37	40	335	34	317	probable pectinesterase
215357	PLN02665	2.21e-36	146	326	160	340	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACO54870.1|CE8	4.20e-209	9	351	9	347
ACO54874.1|CE8	2.80e-205	6	351	6	348
ACO54872.1|CE8|3.1.1.11	8.97e-195	6	351	6	348
ACO54875.1|CE8	8.40e-181	7	351	3	346
ABQ63096.1|CE8	6.56e-166	9	351	6	344

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	4.72e-60	31	350	2	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	6.66e-60	31	350	2	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	8.93e-31	31	324	2	283	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	1.19e-30	50	324	13	279	Chain A, Pectinesterase 1 [Solanum lycopersicum]
4PMH_A	2.68e-11	36	314	32	366	The structure of rice weevil pectin methyl esterase [Sitophilus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12535|PME_ASPAC	5.29e-76	31	350	19	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|P17872|PME_ASPNG	1.89e-73	31	351	19	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|B0Y9F9|PMEA_ASPFC	2.96e-64	11	350	7	324	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1
sp|Q4WBT5|PMEA_ASPFU	2.96e-64	11	350	7	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|A1DBT4|PMEA_NEOFI	1.65e-63	11	350	7	324	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000202	0.999763	CS pos: 17-18. Pr: 0.9754

TMHMM  Annotations     

There is no transmembrane helices in PPTG_06239-t26_1-p1.