CAZyme Information: PPTG_06233-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_06233-t26_1-p1
• CAZy Family: GH12
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
258		27413.96	4.9616

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669569:448226-449058(+)

Full Sequence      

MHPFTLLLAVLGSLVTISAADINTTCSGVNARITPSPGAIVVDSMGAYNGSFRTLAEGVS
NLANTTEEQTIFLYPGVYHEQVFITPLAGPLVLQGYTCNTESYADNQVTITQAKAQRDIP
LNVTGDRNWATSTLGLAASNIKMINLNVANTAGKIGGKVGQAVAVYANGTDYGFYACNFS
SYQDTLCAHNGRELYARTLIRGATDFIFGMNAQAWFEKCDIEVVGKGYVTANGRESESNP
SCVPRSPVASLLACCLPE

Enzyme Prediction     

EC	3.1.1.11:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	49	240	1.8e-42	0.625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178051	PLN02432	8.45e-22	40	238	13	190	putative pectinesterase
215367	PLN02682	2.04e-18	31	236	63	263	pectinesterase family protein
178372	PLN02773	4.73e-18	50	241	15	200	pectinesterase
178504	PLN02916	7.34e-17	34	241	183	380	pectinesterase family protein
215357	PLN02665	1.62e-16	50	241	78	260	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACO54873.1|CE8	9.86e-95	1	241	1	237
ABQ63096.1|CE8	9.86e-95	1	241	1	237
ACO54870.1|CE8	1.95e-92	13	241	10	238
ACO54868.1|CE8	7.95e-91	1	239	1	234
ACO54874.1|CE8	2.64e-90	1	241	1	241

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	1.72e-32	31	239	2	194	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	2.41e-32	31	239	2	194	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1XG2_A	3.52e-11	50	234	13	186	Chain A, Pectinesterase 1 [Solanum lycopersicum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P17872|PME_ASPNG	1.30e-45	31	250	19	232	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q12535|PME_ASPAC	1.01e-44	31	250	19	233	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|A1DBT4|PMEA_NEOFI	4.34e-36	1	234	1	214	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1
sp|Q5B7U0|PMEA_EMENI	1.29e-34	31	241	28	222	Pectinesterase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pmeA PE=1 SV=1
sp|Q2UBD9|PMEA_ASPOR	2.62e-33	49	239	41	219	Probable pectinesterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000202	0.999766	CS pos: 19-20. Pr: 0.9805

TMHMM  Annotations     

There is no transmembrane helices in PPTG_06233-t26_1-p1.