CAZyme Information: PPTG_06231-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_06231-t26_1-p1
• CAZy Family: GH12
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
348	KI669569|CGC3	38247.15	4.9578

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669569:443497-444543(-)

Full Sequence      

MLRVALLFLALVGLASDALPSVDATCSGPNARTVPPPGAIVVDITGTYNGSYQTMAEGMA
YLPNTTEEHIIFVFPGVYQEQVLIPKLAGPLVLQGYTCDTTSYADNKVTVTHTMAQRDLP
LEIKNGRNDLISTMRLKSRSGVKMYNMNVANPAGLIEKLGQAVAVYVDATNYGFYGCNFT
GYKDTLCAHRGRQLYARSFISGAIDFIFGMQAMAWFDSCDIESIGEGYITANGNSNSTIE
SQYVFNRARVLGSSGNGSTYLGRPWRPYARVVWQNSELSDVVNPKGWSTWHNDSNTANVY
FMEFNNSGPGAIIDQRVPFSGQLEAPVVVTDILGENYKSEWWVDTNFF

Enzyme Prediction     

EC	3.1.1.11:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	49	324	1.6e-72	0.9166666666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178372	PLN02773	5.72e-46	50	323	15	282	pectinesterase
395871	Pectinesterase	1.81e-45	40	321	2	276	Pectinesterase.
178051	PLN02432	2.65e-43	39	334	10	287	putative pectinesterase
215367	PLN02682	1.43e-39	36	323	67	347	pectinesterase family protein
178106	PLN02488	3.25e-39	19	321	178	473	probable pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACO54872.1|CE8|3.1.1.11	4.11e-204	10	347	10	347
ACO54874.1|CE8	1.69e-196	10	347	10	347
ACO54870.1|CE8	1.41e-190	9	347	9	346
ABQ63096.1|CE8	1.24e-167	9	347	6	343
ACO54873.1|CE8	3.55e-167	9	347	6	343

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	3.19e-66	31	347	2	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	4.51e-66	31	347	2	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	4.20e-34	40	321	9	283	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	1.54e-32	50	321	13	279	Chain A, Pectinesterase 1 [Solanum lycopersicum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12535|PME_ASPAC	1.89e-78	31	348	19	331	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|P17872|PME_ASPNG	3.82e-75	31	347	19	329	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q4WBT5|PMEA_ASPFU	4.90e-68	32	347	28	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	4.90e-68	32	347	28	324	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1
sp|B8NPS7|PMEA_ASPFN	1.38e-67	12	347	8	324	Probable pectinesterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000202	0.999783	CS pos: 18-19. Pr: 0.9867

TMHMM  Annotations     

There is no transmembrane helices in PPTG_06231-t26_1-p1.