CAZyme Information: PPTG_06070-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_06070-t26_1-p1
• CAZy Family: GH12
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
892	KI669568|CGC2	99441.73	6.4008

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669568:1713562-1716374(-)

Full Sequence      

MSSSPESTAVSEGIASVPDTSSSIPIEGIATLLTVGLGLFYWFCFRPGRIRSPTSPPTNA
ERLSAAFMNERFAVFVEHEISANEAALFVADGGRIEPFRALYDALRVPLHVVDLTRIAGG
SKVLVALHETYAGQVEHEYLFVRGQLVGGLKQLRGLLIDGQKEQLGEKCDWSHVRVDRKS
NTGFMILSTMNGFQGVEEVEEKTVNLETRPLRTVEELRTFDPMTLVGCCVPIASCSRKQR
RRSKLLVCHDMKGGYLEDRFIQGCDDFDAYRFYQWDLVDLFVYFGHALVCPPPSGWIAAG
HRHGTRVLGTFLTEGDEGTELCKELFQDAQSAEMFASKLAAIAWHGGFDGWLINVENDVP
AELVSNIDVFLRTLRKGMQLQNPLAQVVWYGSLSRSGKRSSYARLDESSSEFFRNVDGFY
VDYGWTLDDAKFSAAFDLDRRYDIFMGIDVFGRHGMLGGGKMKCGEPLRLAWNAGVSAAV
FAPGWTYECYQHEVQQDFVVVENRFWSTVRESWKGKSPCYDALGGQNCLYTAFNIGRGVG
VWTEGKRVGTSTWSNMTELDIQPDQALHVGKIVTTATGSMQAVISHDTALHGGASVQLQG
QLVGREKSYFKLFDVDIEFSPRRVMEISYTTATREESVCLLVLTVCPGLDRATHYVILRS
VDDSGPDSGDNRVDLKKTLSTVAKASLEKHFYLPVSTEVFDMEGVNAEAVQGITSDGWCK
KTYRLGGQLWDQKHIVEIGVLCTKKIRKVSGERKDYLAYIGEVCVVGNSGKPAVKAAHRD
IHSQPRCCENARITSFKRNDAESVSFGVQWNFTADGELVRYVLVFTCIDNGERIFVGKSF
DNFLWLDKHAWQRRERATSSSSHASTRLTIELRSVSWAGQSSTCVCQLHLEE

Enzyme Prediction     

EC	3.2.1.96:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH85	251	538	3.1e-67	0.9841269841269841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397623	Glyco_hydro_85	4.64e-104	263	538	1	291	Glycosyl hydrolase family 85. Family of endo-beta-N-acetylglucosaminidases. These enzymes work on a broad spectrum of substrates.
119364	GH85_ENGase	1.58e-95	246	563	1	329	Endo-beta-N-acetylglucosaminidase (ENGase) hydrolyzes the N-N'-diacetylchitobiosyl core of N-glycosylproteins. The beta-1,4-glycosyl bond located between two N-acetylglucosamine residues is hydrolyzed such that N-acetylglucosamine 1 remains with the protein and N-acetylglucosamine 2 forms the reducing end of the released glycan. ENGase is a key enzyme in the processing of free oligosaccharides in the cytosol of eukaryotes. Oligosaccharides formed in the lumen of the endoplasmic reticulum are transported into the cytosol where they are catabolized by cytosolic ENGases and other enzymes, possibly to maximize the reutilization of the component sugars. ENGases have an eight-stranded alpha/beta barrel topology and are classified as a family 85 glycosyl hydrolase (GH85) domain. The GH85 ENGases are sequence-similar to the family 18 glycosyl hydrolases, also known as GH18 chitinases. An ENGase-like protein is also found in bacteria and is included in this alignment model.
227068	COG4724	1.81e-30	262	631	94	479	Endo-beta-N-acetylglucosaminidase D [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VDC78376.1|GH85	3.95e-81	242	643	65	454
CAG7878887.1|GH85	5.49e-81	242	643	80	469
CAE5966838.1|GH85	1.55e-80	230	637	55	450
QHN91514.1|GH85	1.79e-80	210	645	21	448
AEE74996.2|GH85|3.2.1.96	2.85e-80	242	637	67	449

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FHA_A	2.00e-23	262	620	71	441	Chain A, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_B Chain B, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_C Chain C, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_D Chain D, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae]
3FHQ_A	2.00e-23	262	620	71	441	Chain A, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_B Chain B, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_D Chain D, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_F Chain F, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae]
2VTF_A	4.73e-23	262	620	76	446	X-ray crystal structure of the Endo-beta-N-acetylglucosaminidase from Arthrobacter protophormiae E173Q mutant reveals a TIM barrel catalytic domain and two ancillary domains [Glutamicibacter protophormiae],2VTF_B X-ray crystal structure of the Endo-beta-N-acetylglucosaminidase from Arthrobacter protophormiae E173Q mutant reveals a TIM barrel catalytic domain and two ancillary domains [Glutamicibacter protophormiae]
2W91_A	3.95e-16	257	629	70	458	Structure of a Streptococcus pneumoniae family 85 glycoside hydrolase, Endo-D. [Streptococcus pneumoniae TIGR4],2W92_A Structure of a Streptococcus pneumoniae family 85 glycoside hydrolase, Endo-D, in complex with NAG-thiazoline. [Streptococcus pneumoniae TIGR4]
3GDB_A	5.34e-16	257	629	221	609	Crystal structure of Spr0440 glycoside hydrolase domain, Endo-D from Streptococcus pneumoniae R6 [Streptococcus pneumoniae R6]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|F4JZC2|ENAS1_ARATH	7.00e-80	210	657	25	466	Cytosolic endo-beta-N-acetylglucosaminidase 1 OS=Arabidopsis thaliana OX=3702 GN=ENGASE1 PE=1 SV=1
sp|Q9SRL4|ENAS2_ARATH	7.67e-79	242	637	67	471	Cytosolic endo-beta-N-acetylglucosaminidase 2 OS=Arabidopsis thaliana OX=3702 GN=ENGASE2 PE=1 SV=1
sp|Q8BX80|ENASE_MOUSE	1.01e-67	208	629	72	491	Cytosolic endo-beta-N-acetylglucosaminidase OS=Mus musculus OX=10090 GN=Engase PE=1 SV=1
sp|P0C7A1|ENASE_CHICK	4.43e-67	211	612	85	474	Cytosolic endo-beta-N-acetylglucosaminidase OS=Gallus gallus OX=9031 GN=ENGASE PE=1 SV=1
sp|Q8NFI3|ENASE_HUMAN	3.05e-64	211	629	87	499	Cytosolic endo-beta-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=ENGASE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000094	0.000003

TMHMM  Annotations     

There is no transmembrane helices in PPTG_06070-t26_1-p1.