CAZyme Information: PPTG_05922-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_05922-t26_1-p1
• CAZy Family: GH12
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
355		38183.40	6.1176

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669568:1179216-1180437(+)

Full Sequence      

MGADSQVPLRWGFIGCGKIANDFVNALKGMAGETARLSACAARSLETAQQFAKTHGFAHA
YGSYEELCEDRDVDVVYIATIHLVHFEQITLALNHGKHVLVEKPMTMNAKQTASVVELAK
TKKLFLMEGVWTRCFPFLKFVRQLLSEGNIGDVHHVHGDIGIPYVNSKNEANFRSSSGDG
ALLGIGIYPLSFVTMVFGTEPLKITTTGKTSSGGADIYGSATLEYSGNRIGTINFTALAT
LGNSVTITGSKGRICIPAPAHCATEVTVTQFLEDGTQQTKTMQFPWPTPSTNIATPFNYP
GSEALVYEAETVTKAIGSGQLQCEEYPPEESLAIAKFMDEIRGAIGVVYAADSAH

Enzyme Prediction     

No EC number prediction in PPTG_05922-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	9	159	1.1e-20	0.39348370927318294

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223745	MviM	4.77e-59	8	346	3	333	Predicted dehydrogenase [General function prediction only].
396129	GFO_IDH_MocA	1.95e-23	9	129	1	119	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
275173	myo_inos_iolG	3.13e-19	8	284	1	276	inositol 2-dehydrogenase. All members of the seed alignment for this model are known or predicted inositol 2-dehydrogenase sequences co-clustered with other enzymes for catabolism of myo-inositol or closely related compounds. Inositol 2-dehydrogenase catalyzes the first step in inositol catabolism. Members of this family may vary somewhat in their ranges of acceptable substrates and some may act on analogs to myo-inositol rather than myo-inositol per se. [Energy metabolism, Sugars]
182305	PRK10206	1.72e-09	13	198	6	187	putative oxidoreductase; Provisional
183212	PRK11579	5.32e-09	65	230	57	223	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS38310.1|GH0	4.58e-10	61	254	82	291
BDC49873.1|GH0	4.58e-10	61	254	82	291
QYR11531.1|GH109	8.61e-10	64	158	124	218
BDF54821.1|GH109	1.43e-09	9	158	61	217
QRO51930.1|GH109	2.47e-09	9	158	45	201

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2O48_X	6.73e-57	7	352	1	332	Crystal structure of Mammalian Dimeric Dihydrodiol Dehydrogenase [Macaca fascicularis],2O4U_X Crystal structure of Mammalian Dimeric Dihydrodiol Dehydrogenase [Macaca fascicularis],2POQ_X Dimeric Dihydrodiol Dehydrogenase complexed with inhibitor, Isoascorbic acid [Macaca fascicularis],3OHS_X Crystal Structure of Mammalian Dimeric Dihydrodiol Dehydrogenase in complex with Dihydroxyacetone [Macaca fascicularis]
3E9M_A	1.15e-35	9	257	6	251	Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_B Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_C Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_D Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis]
3EVN_A	2.18e-28	5	257	2	251	CRYSTAL STRUCTURE OF putative oxidoreductase from Streptococcus agalactiae 2603V/r [Streptococcus agalactiae serogroup V]
4HAD_A	8.89e-24	6	225	21	239	Crystal structure of probable oxidoreductase protein from Rhizobium etli CFN 42 [Rhizobium etli CFN 42],4HAD_B Crystal structure of probable oxidoreductase protein from Rhizobium etli CFN 42 [Rhizobium etli CFN 42],4HAD_C Crystal structure of probable oxidoreductase protein from Rhizobium etli CFN 42 [Rhizobium etli CFN 42],4HAD_D Crystal structure of probable oxidoreductase protein from Rhizobium etli CFN 42 [Rhizobium etli CFN 42]
3RBV_A	3.54e-21	8	200	27	216	Crystal Structure of KijD10, a 3-ketoreductase from Actinomadura kijaniata incomplex with NADP [Actinomadura kijaniata],3RC1_A Crystal Structure of KijD10, a 3-ketoreductase from Actinomadura kijaniata incomplex with NADP and TDP-benzene [Actinomadura kijaniata],3RC2_A Crystal Structure of KijD10, a 3-ketoreductase from Actinomadura kijaniata in complex with TDP-benzene and NADP; open conformation [Actinomadura kijaniata]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q642M9|DHDH_DANRE	4.57e-67	7	353	1	333	Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Danio rerio OX=7955 GN=dhdh PE=2 SV=2
sp|Q6DF30|DHDH_XENTR	8.74e-63	10	349	4	329	Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Xenopus tropicalis OX=8364 GN=dhdh PE=2 SV=1
sp|Q6DKE0|DHDH_XENLA	1.92e-61	10	349	4	329	Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Xenopus laevis OX=8355 GN=dhdh PE=2 SV=1
sp|Q9TV69|DHDH_PIG	3.79e-59	7	352	1	333	Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Sus scrofa OX=9823 GN=DHDH PE=1 SV=1
sp|Q148L6|DHDH_BOVIN	1.06e-58	7	352	1	333	Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Bos taurus OX=9913 GN=DHDH PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000072	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PPTG_05922-t26_1-p1.