CAZyme Information: PPTG_05287-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_05287-t26_1-p1
• CAZy Family: GH1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
338		36276.24	9.6268

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669567:852834-853850(+)

Full Sequence      

MQFLAPLVALACLIAGAEGACTGPNARTTPPPGAIVVDITGSYRGSFKTVSAGVAKLSTA
TGDSTLFLMPGIYKEKVTVPPLKGKLVIQGYTCDTTSYSANQVTITRAMAQKDVPASITK
NRNDYTATVLLKSSNVKVYNLNVANTAGNVGQAIALKVDGANYGLYACKLMGYQDTLYAN
KGPALFAKSYINGAIDFVFGLYAKTWFESCHIESIGNGCITANGRTDNSNPSEYVFNNAR
VFGSKPGQAFLGRPWRPYARVVFQNSDLSDVVNPAGWQKWNGDNNTGNVYFKEFNNRGAG
AATNKRVPFSGKLQKPVAIAEILGQGYESAWWVDKSFM

Enzyme Prediction     

EC	3.1.1.11:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	43	314	1.3e-74	0.9201388888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215173	PLN02304	4.59e-48	30	313	67	354	probable pectinesterase
178051	PLN02432	1.27e-46	34	313	10	272	putative pectinesterase
395871	Pectinesterase	2.69e-46	35	311	2	276	Pectinesterase.
215117	PLN02176	7.82e-46	35	313	41	313	putative pectinesterase
178113	PLN02497	1.26e-43	35	313	34	306	probable pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFM08806.1|CE8	2.06e-231	1	338	1	338
ACO54869.1|CE8	8.92e-210	1	338	1	338
ACO54873.1|CE8	8.23e-154	3	338	4	344
ABQ63096.1|CE8	3.34e-153	3	338	4	344
ACO54868.1|CE8	1.51e-146	1	338	1	343

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1E_A	9.57e-56	25	337	1	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	1.35e-55	25	337	1	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
1GQ8_A	1.20e-35	35	311	9	283	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	6.39e-33	35	311	7	279	Chain A, Pectinesterase 1 [Solanum lycopersicum]
3UW0_A	6.96e-13	55	305	49	339	Pectin methylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P17872|PME_ASPNG	6.20e-74	27	338	20	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q12535|PME_ASPAC	3.50e-70	27	337	20	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|Q4WBT5|PMEA_ASPFU	5.65e-67	27	337	28	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	5.65e-67	27	337	28	324	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1
sp|A1DBT4|PMEA_NEOFI	4.47e-66	27	337	28	324	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000228	0.999725	CS pos: 19-20. Pr: 0.9784

TMHMM  Annotations     

There is no transmembrane helices in PPTG_05287-t26_1-p1.