CAZyme Information: PPTG_05150-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_05150-t26_1-p1
• CAZy Family: PL3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
584		66173.62	6.7099

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669567:481441-483195(+)

Full Sequence      

SQFFTMGIRPSRTDGASVGGRQRRRHLSVLLIAALILSCCSAQTSKAKARAPATVAPESV
VEPNEGAFATIMYDFGEDSEALLLATRVLMRSIKDSNTKYRRMVIVPQDGLQESSERALK
GDDPDLEIVRTNIPNVFAHMPLTDHRTQLLHMRNKLVIWDDPQISSLKRVVYLDPENLVL
RNLDEIFACHQFCAVDNGQSVVYSNGLLVISPDSIVARNLYSDAIDGFMITGREYNYIGI
IQGFMPGLFEAFEESPLFFLGWDGDDNGEESDGADDGDDAVDAVDVSVVHRLPFYYSINH
MVFYERMNWDLYKCKDKNLAKGEIPGPLLSYKYSGATVKPWFWLPYTYFQVFWYWQDVRA
RLGEDHFGNFLGRVVSFLVIFAFIWFAYISLCLKLFTEPNGRPRRLSSWGLPTPGNAQPL
SIDVFNSRMVRRACQFSCSALYAIASMPLVSSVSIVVLLTWCSIQVIPITMQPSYAGKLW
VIVHDLMLTTLLLIFAVAHTLRTAQWKKDEVPATSDMLLGGIWWCVKKLPLLVLAQLQFL
YMIGRTDWFQNPVLRPVMTFLFFATAAIVEGRILVVEMHRITRN

Enzyme Prediction     

No EC number prediction in PPTG_05150-t26_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	2.04e-17	67	245	2	163	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28025.1|GT8	0.0	72	584	1	515
CCA23792.1|GT8	7.98e-166	29	574	12	572
UIZ21271.1|GT8	7.40e-21	67	394	38	364
CCA16211.1|GT8	1.28e-18	67	366	48	327
BAT75850.1|GT8	2.56e-18	16	361	10	300

PDB Hits     

PPTG_05150-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|F4JMI5|GUX7_ARATH	8.05e-16	64	366	57	308	Putative glucuronosyltransferase PGSIP7 OS=Arabidopsis thaliana OX=3702 GN=PGSIP7 PE=3 SV=1
sp|Q8VZP6|GUX8_ARATH	4.47e-15	64	363	61	318	Putative glucuronosyltransferase PGSIP8 OS=Arabidopsis thaliana OX=3702 GN=PGSIP8 PE=2 SV=1
sp|Q8GWB7|GUX6_ARATH	9.94e-12	62	258	27	200	Inositol phosphorylceramide glucuronosyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=IPUT1 PE=1 SV=1
sp|Q8GWW4|GUX2_ARATH	9.68e-07	63	241	298	461	UDP-glucuronate:xylan alpha-glucuronosyltransferase 2 OS=Arabidopsis thaliana OX=3702 GN=GUX2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.018723	0.981269	CS pos: 39-40. Pr: 0.6722

TMHMM  Annotations     

Start	End
374	396
438	460
480	499
520	542
557	576