CAZyme Information: PPTG_05117-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_05117-t26_1-p1
• CAZy Family: GH1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
490		51022.67	4.2641

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669567:395424-396896(+)

Full Sequence      

MKIFRCGFIAAFALAMHTAAAISTGTAPGLASAATGGGDTDPVYPTTIDELTSYLSDDET
RVIILQQEFDYRGSEGTTTEDGCRPLSNQQCIAKNNGCKGQDVILQSGGMSGTGGCTDGV
SVEVTYDNAGPNPLQVQGNKTIRGIGTSGVIIGKGLWILGSNVIVQNIHITNLNPHLIWG
GDAIYIQGADGGETSLENVWLDHVKISSIGRQMIATNTASVKSMTISNCDFDGYTEYSAS
CDNRHYWTMLFYGTETQVSLVNNYIHQTSGRSPKVGGNTILHAANNYFYNNSGHNFAPTE
ESYTVAEGNYMDTCTAPVLLDDDATGAFMVPASDTQSYCESALGRDCVVNTVVSSDAELT
GQNEESAVTTAQTVAKAYKPSAAGKLSLSSANFGVGDLDAVDGSSSLSSTSTLTTSTTAT
PTVASTTASGSASTTSAASNAASTASSDTTVQETSYTFTSSNAQSIDAPSQTESTSSVTG
EADSHRQHHL

Enzyme Prediction     

EC	4.2.2.10:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	124	312	3.1e-80	0.983957219251337

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	8.91e-31	124	310	4	185	Amb_all domain.
226384	PelB	1.76e-10	134	335	97	298	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	6.10e-09	132	309	28	209	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR19254.1|PL1_4	9.22e-268	1	406	1	406
ACR19247.1|PL1_4|4.2.2.10	2.93e-175	1	398	1	398
ACR19251.1|PL1_4	2.93e-175	1	398	1	398
ACR19255.1|PL1_4	5.89e-175	1	398	1	398
ACR19252.1|PL1_4	2.27e-165	22	398	56	432

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IDJ_A	1.66e-80	24	350	4	313	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
1IDK_A	3.30e-80	24	355	4	318	Pectin Lyase A [Aspergillus niger]
1QCX_A	3.13e-77	25	394	5	358	Pectin Lyase B [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8NJK6|PELF_ASPNG	3.15e-90	24	406	25	391	Probable pectin lyase F OS=Aspergillus niger OX=5061 GN=pelF PE=3 SV=1
sp|A2R6A1|PELF_ASPNC	3.15e-90	24	406	25	391	Probable pectin lyase F OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelF PE=3 SV=1
sp|Q5BA61|PELB_EMENI	1.94e-87	13	385	12	376	Pectin lyase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pelB PE=2 SV=1
sp|B0YCL3|PELB_ASPFC	2.69e-86	25	363	24	344	Probable pectin lyase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pelB PE=3 SV=2
sp|Q0CZD4|PELF2_ASPTN	1.12e-84	1	355	1	338	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000291	0.999680	CS pos: 33-34. Pr: 0.7633

TMHMM  Annotations     

There is no transmembrane helices in PPTG_05117-t26_1-p1.