CAZyme Information: PPTG_04618-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_04618-t26_1-p1
• CAZy Family: CE5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
326		34587.79	4.4183

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669565:1014425-1015405(+)

Full Sequence      

MVSTTSILAMAAAVATTVDYVQAHGYIAKPAPSWKDKETNDWVVEIEPQWKGGWDESKGD
EGLLATFKELAPKNNYKDVRSLMDGNPVYGEDCGFTDPKGTPSEPPSDGTATFSRGIVHA
GPCEIWLDDKMVLQNDDCQSAYGDGTQKTISVFKPVDYSSCASGGCMLRFYWLALQRLDG
KTVWQAYKNCIPLTGPAGGGASQQTPSTGGGSDTSQKSPDEDPSQTAPSTGDSSKKEESD
GSKKEDKKEESDGSKKEDKKEDTPSGGDSPSSPETPPSGGDSPETPPSGGDSPATPAPET
PSAETPEMSPVPAPSSKCNGRRRRRY

Enzyme Prediction     

EC	1.14.99.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA17	11	262	3.5e-67	0.9346938775510204

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
236090	PRK07764	2.75e-04	183	315	581	712	DNA polymerase III subunits gamma and tau; Validated
185628	PTZ00449	0.001	196	312	511	621	104 kDa microneme/rhoptry antigen; Provisional
236090	PRK07764	0.002	195	316	589	715	DNA polymerase III subunits gamma and tau; Validated
223039	PHA03307	0.003	191	325	263	401	transcriptional regulator ICP4; Provisional
223003	PHA03169	0.004	199	313	90	205	hypothetical protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ETI38760.1|AA17	1.43e-193	1	326	1	326
ETK78975.1|AA17	5.81e-193	1	326	1	326
EEY68486.1|AA17|1.14.99.-	2.25e-153	1	224	1	224
EGZ23516.1|AA17	1.64e-144	1	212	1	212
ETK78976.1|AA17	3.17e-117	1	324	1	275

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Z5Y_A	1.04e-124	24	195	1	172	Chain A, Lytic Polysaccharide Monooxygenase [Phytophthora infestans T30-4],6Z5Y_B Chain B, Lytic Polysaccharide Monooxygenase [Phytophthora infestans T30-4]

Swiss-Prot Hits     

PPTG_04618-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.864510	0.135508

TMHMM  Annotations     

There is no transmembrane helices in PPTG_04618-t26_1-p1.