CAZyme Information: PPTG_04136-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_04136-t26_1-p1
• CAZy Family: CBM47
• CAZyme Description: hypothetical protein, variant 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
267		30305.71	6.8300

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669566:1337324-1338361(-)

Full Sequence      

MAPKRLAHEVHDGDNKKRRRRSNGAACPGQSEPFKTQCAITTAPEETEAPPQDKRSSSAM
QDTTRVAVLVPFRDNHPAQKRQAQLDEFVPYMTEFLKRHCALKSASFHIFIIDQSLDGRK
FNRGKLLNAGFDMARNDYDLYIFHDVDLLPGDDLGELYTTIPTLGPMHIARVWDRYNESS
TYFGGIVAFTFQQFIKVNGFPNNFWGWGGEDNELYSRVWHNSRPRGTQSGRKVGSASNEQ
GEMHREVRPAEGASSHVEEERTEESAL

Enzyme Prediction     

EC	2.4.1.-:5

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT7	52	221	2.3e-50	0.64

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
132999	b4GalT	6.27e-55	65	218	3	147	Beta-4-Galactosyltransferase is involved in the formation of the poly-N-acetyllactosamine core structures present in glycoproteins and glycosphingolipids. Beta-4-Galactosyltransferase transfers galactose from uridine diphosphogalactose to the terminal beta-N-acetylglucosamine residues, hereby forming the poly-N-acetyllactosamine core structures present in glycoproteins and glycosphingolipids. At least seven homologous beta-4-galactosyltransferase isoforms have been identified that use different types of glycoproteins and glycolipids as substrates. Of the seven identified members of the beta-1,4-galactosyltransferase subfamily (beta1,4-Gal-T1 to -T7), b1,4-Gal-T1 is most characterized (biochemically). It is a Golgi-resident type II membrane enzyme with a cytoplasmic domain, membrane spanning region, and a stem region and catalytic domain facing the lumen.
404599	Glyco_transf_7N	6.22e-20	64	159	47	132	N-terminal region of glycosyl transferase group 7. This is the N-terminal half of a family of galactosyltransferases from a wide range of Metazoa with three related galactosyltransferases activities, all three of which are possessed by one sequence in some cases. EC:2.4.1.90, N-acetyllactosamine synthase; EC:2.4.1.38, Beta-N-acetylglucosaminyl-glycopeptide beta-1,4- galactosyltransferase; and EC:2.4.1.22 Lactose synthase. Note that N-acetyllactosamine synthase is a component of Lactose synthase along with alpha-lactalbumin, in the absence of alpha-lactalbumin EC:2.4.1.90 is the catalyzed reaction.
397018	Glyco_transf_7C	9.49e-20	165	227	1	68	N-terminal domain of galactosyltransferase. This is the N-terminal domain of a family of galactosyltransferases from a wide range of Metazoa with three related galactosyltransferases activities, all three of which are possessed by one sequence in some cases. EC:2.4.1.90, N-acetyllactosamine synthase; EC:2.4.1.38, Beta-N-acetylglucosaminyl-glycopeptide beta-1,4- galactosyltransferase; and EC:2.4.1.22 Lactose synthase. Note that N-acetyllactosamine synthase is a component of Lactose synthase along with alpha-lactalbumin, in the absence of alpha-lactalbumin EC:2.4.1.90 is the catalyzed reaction.
133042	GT2_Chondriotin_Pol_N	2.97e-06	184	221	128	165	N-terminal domain of Chondroitin polymerase functions as a GalNAc transferase. Chondroitin polymerase is a two domain, bi-functional protein. The N-terminal domain functions as a GalNAc transferase. The bacterial chondroitin polymerase catalyzes elongation of the chondroitin chain by alternatively transferring the GlcUA and GalNAc moiety from UDP-GlcUA and UDP-GalNAc to the non-reducing ends of the chondroitin chain. The enzyme consists of N-terminal and C-terminal domains in which the two active sites catalyze the addition of GalNAc and GlcUA, respectively. Chondroitin chains range from 40 to over 100 repeating units of the disaccharide. Sulfated chondroitins are involved in the regulation of various biological functions such as central nervous system development, wound repair, infection, growth factor signaling, and morphogenesis, in addition to its conventional structural roles. In Caenorhabditis elegans, chondroitin is an essential factor for the worm to undergo cytokinesis and cell division. Chondroitin is synthesized as proteoglycans, sulfated and secreted to the cell surface or extracellular matrix.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ21452.1|GT7	8.49e-92	9	218	12	214
CAG5081176.1|GT7	6.04e-31	66	218	149	298
AIE96983.1|GT7	3.42e-28	53	217	1739	1907
CAJ77189.1|GT7	7.33e-28	65	218	36	178
CAJ77192.1|GT7	7.83e-28	43	218	58	217

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3LW6_A	1.96e-29	65	218	52	194	Crystal Structure of Drosophila beta1,4-galactosyltransferase-7 [Drosophila melanogaster],4LW6_A Crystal structure of catalytic domain of Drosophila beta1,4galactosyltransferase 7 complex with xylobiose [Drosophila melanogaster]
1NHE_B	3.76e-29	65	218	65	209	Crystal structure of Lactose synthase complex with UDP [Bos taurus],1NHE_D Crystal structure of Lactose synthase complex with UDP [Bos taurus]
1NMM_B	7.34e-29	65	218	65	209	Chain B, BETA-1,4-GALACTOSYLTRANSFERASE [Bos taurus],1NMM_D Chain D, BETA-1,4-GALACTOSYLTRANSFERASE [Bos taurus],1O0R_A Chain A, beta-1,4-galactosyltransferase [Bos taurus],1O0R_B Chain B, beta-1,4-galactosyltransferase [Bos taurus]
1TVY_A	7.34e-29	65	218	65	209	Chain A, Beta-1,4-galactosyltransferase 1 [Bos taurus],1TVY_B Chain B, Beta-1,4-galactosyltransferase 1 [Bos taurus],1TW1_A Chain A, Beta-1,4-galactosyltransferase 1 [Bos taurus],1TW1_B Chain B, Beta-1,4-galactosyltransferase 1 [Bos taurus],1TW5_A Chain A, Beta-1,4-galactosyltransferase 1 [Bos taurus],1TW5_B Chain B, Beta-1,4-galactosyltransferase 1 [Bos taurus],2FYC_B Chain B, beta-1,4-galactosyltransferase [Bos taurus],2FYC_D Chain D, beta-1,4-galactosyltransferase [Bos taurus],4KRV_A Crystal structure of catalytic domain of bovine beta1,4-galactosyltransferase mutant M344H-GalT1 complex with 6-sulfo-GlcNAc [Bos taurus],4KRV_B Crystal structure of catalytic domain of bovine beta1,4-galactosyltransferase mutant M344H-GalT1 complex with 6-sulfo-GlcNAc [Bos taurus]
1NF5_B	7.34e-29	65	218	65	209	Crystal Structure of Lactose Synthase, Complex with Glucose [Bos taurus],1NF5_D Crystal Structure of Lactose Synthase, Complex with Glucose [Bos taurus],1NKH_B Crystal structure of Lactose synthase complex with UDP and Manganese [Bos taurus],1NKH_D Crystal structure of Lactose synthase complex with UDP and Manganese [Bos taurus],1NQI_B crystal structure of lactose synthase, a 1:1 complex between beta1,4-galactosyltransferase and alpha-lactalbumin in the presence of GlcNAc [Bos taurus],1NQI_D crystal structure of lactose synthase, a 1:1 complex between beta1,4-galactosyltransferase and alpha-lactalbumin in the presence of GlcNAc [Bos taurus],1NWG_B Beta-1,4-Galactosyltransferase Complex With Alpha- Lactalbumin And N-Butanoyl-Glucoamine [Bos taurus],1NWG_D Beta-1,4-Galactosyltransferase Complex With Alpha- Lactalbumin And N-Butanoyl-Glucoamine [Bos taurus],1O23_B Crystal Structure Of Lactose Synthase In The Presence Of Udp-glucose [Bos taurus],1O23_D Crystal Structure Of Lactose Synthase In The Presence Of Udp-glucose [Bos taurus],1OQM_B A 1:1 complex between alpha-lactalbumin and beta1,4-galactosyltransferase in the presence of UDP-N-acetyl-galactosamine [Bos taurus],1OQM_D A 1:1 complex between alpha-lactalbumin and beta1,4-galactosyltransferase in the presence of UDP-N-acetyl-galactosamine [Bos taurus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P15535|B4GT1_MOUSE	2.44e-28	65	220	178	324	Beta-1,4-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=B4galt1 PE=1 SV=1
sp|P08037|B4GT1_BOVIN	2.47e-27	65	218	181	325	Beta-1,4-galactosyltransferase 1 OS=Bos taurus OX=9913 GN=B4GALT1 PE=1 SV=3
sp|Q9JJ04|B4GT4_MOUSE	1.08e-26	11	218	65	267	Beta-1,4-galactosyltransferase 4 OS=Mus musculus OX=10090 GN=B4galt4 PE=2 SV=1
sp|P15291|B4GT1_HUMAN	1.19e-26	65	218	177	321	Beta-1,4-galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=B4GALT1 PE=1 SV=5
sp|Q9GUM2|BRE4_CAEEL	1.89e-26	65	218	149	293	Beta-1,4-N-acetylgalactosaminyltransferase bre-4 OS=Caenorhabditis elegans OX=6239 GN=bre-4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.997602	0.002428

TMHMM  Annotations     

There is no transmembrane helices in PPTG_04136-t26_1-p1.