CAZyme Information: PPTG_03706-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_03706-t26_1-p1
• CAZy Family: AA6
• CAZyme Description: trehalose-phosphatase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1246		137925.22	5.4462

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669564:2604103-2607899(-)

Full Sequence      

MLQRLRHAVGWGLPASPPGTRVDFQVCAPLGHGQTLWLVGDLPALGGSVDVVPNTGGAGA
EGGLQLVTTPDLYPIWYNLEPVLAPAGSVVRYRYAVCSGSRFLRYEGTAESGPVTRELTV
GVGYVQTQDTLDGRPRRRSSVCSDDDTTGTSTVVNSDADQTADASDEDVPPPAFWGVIPR
LSSGQAFVDRRANGTEDGGSTLHRNNRRPPGSGRLLTDVMEENEQTASPTASLSRHASAR
VRTGSGPMLGEEVASPTSPRPTASNVTMEATDGVIIAVHRLPVLVHRTPEGHYHIEWEDD
NLICPSGLLKDSYREANWDRVSSMRLTWVGTVHCAEPIPKEDEERLAKQLEDFHCVPVFL
SEPLGSTFHNFCYGTLWPVFHNIVDVYGALPTRWWNPSQQRNAWASYKTVNRIFVNKVIE
VYNEGDLVWVHGLHLLVAPSFLTRRLPCVNVGIFLHTPFPSSEIFRTLSMRADLLRGVLA
SDHIGFHLYEHARHFLTSCRRILGLKYSVQPGGYIGVEYNGRMVMLTISHIGIEPSFMDR
INSSVQVEQDTAVLAAKYESSKRKVFVSVDRVERLKGILLKLGAIEFFLAQHPEYVDKVQ
FVQIGIWDSSNPTPEKDSVRAEILAHMKRINDRFGANRNEPVFAYSEVENTDMASRLPLW
RVGHVLLTTSVRDAVNLYPFEFIYAHELAKSPGVVIVSEFSGSSRVLTGSVAVNPWKRDE
IIQAMELALTMSDEERAARHQKDLEYIITNSRTKWAERILVDLKRTKKQTAEGEYMGYGL
GLGFRMLEFNAGFKMLETDVVAKAYRDTFRRVIFFDYGNTLTLEEPAGTHNFSKYITGNE
QNAFVSKTEAPKASSDLLASLTLLCADPRNTVFVLSGKERLDLEKTLGSVRGLGLAAEHG
YLYKWGTGANASAGSMAQPSSSSSSNSMASEVEEGVWLCTKDNFDDSWKDVTHAVMDIYT
QRTHGTYIELKGSALLWQYRDADPEFGQLQAKELHDQLLQVLEHFQVEVVTGTDYLEVRP
EGVDKGVIVDRVLSTIESTSGQYVDFILCVGDDLSDEFMFQYLEDVRSRRNMFTVTVGKK
PSAAKYFVNDVDQVMEIVHAMTKVSTAAKRNFSMNDLRLFDRNTTSGGLLSFQRNEAGLN
RPSGNLGYMSDGSFEDMKSSPFESLAEGEEAPATEENMQSSTTNSLAGRGIAGRSLGGAM
GGRNSMSMSSLSTAGMPSLHPTSSTYEQYLSNVDEAAEEEEGGIFF

Enzyme Prediction     

No EC number prediction in PPTG_03706-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	264	765	3.4e-128	0.9894736842105263

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
177855	PLN02205	0.0	228	1105	17	848	alpha,alpha-trehalose-phosphate synthase [UDP-forming]
184712	PRK14501	9.97e-154	273	1104	2	726	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
340820	GT20_TPS	1.92e-138	274	764	2	463	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
215555	PLN03063	2.04e-135	274	1113	13	795	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
395781	Glyco_transf_20	1.72e-130	274	765	3	470	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ24099.1|GT20	0.0	1	1246	1	1264
CCA19238.1|GT20	0.0	1	1246	1	1179
AGT20052.1|CBM20|GT20	1.28e-194	17	1065	5	950
UIZ27356.1|GT20	1.74e-182	274	1124	24	852
BBN16912.1|GT20	3.44e-167	240	1105	27	836

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HVM_A	1.07e-81	261	771	2	482	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
6JBI_A	4.25e-80	274	765	2	464	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HVO_A	1.62e-79	268	763	1	474	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HUV_A	2.17e-76	274	769	6	473	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]
5HUT_A	4.96e-75	274	769	6	473	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q94AH8|TPS6_ARATH	9.21e-153	263	1105	44	854	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 OS=Arabidopsis thaliana OX=3702 GN=TPS6 PE=1 SV=2
sp|O23617|TPS5_ARATH	3.72e-152	272	1106	60	844	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 5 OS=Arabidopsis thaliana OX=3702 GN=TPS5 PE=1 SV=2
sp|Q9LMI0|TPS7_ARATH	6.37e-148	262	1117	49	847	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 7 OS=Arabidopsis thaliana OX=3702 GN=TPS7 PE=1 SV=1
sp|Q9LRA7|TPS9_ARATH	7.36e-147	265	1119	52	857	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 OS=Arabidopsis thaliana OX=3702 GN=TPS9 PE=2 SV=1
sp|Q9ZV48|TPS11_ARATH	1.35e-144	275	1109	53	839	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 11 OS=Arabidopsis thaliana OX=3702 GN=TPS11 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000042	0.000029

TMHMM  Annotations     

There is no transmembrane helices in PPTG_03706-t26_1-p1.