CAZyme Information: PPTG_03687-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_03687-t26_1-p1
• CAZy Family: AA6
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
805	KI669564|CGC6	86589.63	4.2584

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669564:2530012-2532492(-)

Full Sequence      

MLPRLASALSAIAIAGSSTSPVSAATTDYPLGPFTVSVDTDGSSVEIANSAGDQVWKSAS
DRTFISASSGLTTITQASGNFQLSSENVGAPCQTATISGVISSSSDRVDISGSFGDAACS
DWTWSLSFALESSSGDDSQPLVFNASVVGDNVDNVYIAYESPKDESFFGLGEQTGIGNLR
GWRVPVWTREGGVGRGEEPVTTYLNENASISGAFAGGSLLTTYTGVGSLTSSLGRWVVLD
GTKYALFDLASNATSAFEDTAAGYLAGNITDGDHATGSTTTLEIMYESSSLNGWLGRTAT
GNPLLEATNALTKVTGRQPELPDWSHDGAILGIQGGQDFVEEVIQNALSANMPLVSVWLQ
DWSGTRLQTGAYGISLHRLWWNWEPDTTLYPTWAKWVPHLQSTYGVRTMSYINTFLANVS
TKSTGYNTSFYAIAASEGRFVANATAGDGSAWTITSGPGIDAGLLDLSNQSTIDWFKELV
KQQYYSVPISGMMQDFGEYLSVDDSVSLSGGTVNSRVFHNDYPTVWATLLRDVVTELGLE
NDTIGFHRSAGTFSAKHTNLFWVGDQNIDESREDGMRAVISSTLHVGASGFAQTHSDIGG
YTNTLATVGNITRNAALLGRWGELGAFSGTAFRTHEGNIPQMNVQAYTNETTRAYHAYNA
RLFRSLKPYRLALLEEYQMNGWPLVRHPMVYSPNDSVASTVIDETFWFGEALYVAPVYDL
SASSVEVYLPPLQVDSHGAAVNSTAFTYKHLWSGEEYAPGQTVTVDAPWGEPGVFMRWPV
TEKEGLQLQQLWEFVVAENATILEA

Enzyme Prediction     

No EC number prediction in PPTG_03687-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	300	777	3.1e-60	0.9765807962529274

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
236691	PRK10426	1.19e-146	151	777	68	618	alpha-glucosidase; Provisional
269880	GH31_glucosidase_YihQ	2.00e-142	316	660	1	325	alpha-glucosidase YihQ-like. YihQ is a bacterial alpha-glucosidase with a conserved glycosyl hydrolase family 31 (GH31) domain that catalyzes the release of an alpha-glucosyl residue from the non-reducing end of alpha-glucoside substrates such as alpha-glucosyl fluoride. Orthologs of YihQ that have not yet been functionally characterized are present in plants and fungi. YihQ has sequence similarity to other GH31 enzymes such as CtsZ, a 6-alpha-glucosyltransferase from Bacillus globisporus, and YicI, an alpha-xylosidase from Echerichia coli. These latter two belong to different GH31 subfamilies than YihQ. In bacteria, YihQ (along with YihO) is important for bacterial O-antigen capsule assembly and translocation.
224418	YicI	1.70e-55	300	795	240	687	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
395838	Glyco_hydro_31	2.82e-40	300	777	4	437	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
269878	GH31_NET37	6.15e-27	338	731	22	361	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK39259.1|GH31	1.26e-166	64	805	60	768
UJO15759.1|GH31	1.77e-166	40	803	42	765
USW53386.1|GH31	1.10e-164	51	803	53	765
BCS07610.1|GH31	2.18e-164	21	805	17	768
BCR95040.1|GH31	2.18e-164	21	805	17	768

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6PNR_A	9.67e-79	150	777	97	649	Chain A, Alpha-glucosidase [[Eubacterium] rectale],6PNR_C Chain C, Alpha-glucosidase [[Eubacterium] rectale]
5OHY_A	4.18e-74	146	777	91	648	Chain A, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens]
5OHS_A	2.12e-73	146	777	91	648	Chain A, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_E Chain E, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_F Chain F, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_G Chain G, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_H Chain H, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_A Chain A, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens]
5AED_A	1.18e-68	134	777	96	663	A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AED_B A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AEG_A A bacterial protein structure in glycoside hydrolase family 31. [Escherichia coli K-12],5AEG_B A bacterial protein structure in glycoside hydrolase family 31. [Escherichia coli K-12],5OHT_A A GH31 family sulfoquinovosidase from E. coli in complex with aza-sugar inhibitor IFGSQ [Escherichia coli K-12],5OHT_B A GH31 family sulfoquinovosidase from E. coli in complex with aza-sugar inhibitor IFGSQ [Escherichia coli K-12]
5AEE_A	5.85e-68	134	777	96	663	A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AEE_B A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32138|SQASE_ECOLI	5.21e-68	134	777	96	663	Sulfoquinovosidase OS=Escherichia coli (strain K12) OX=83333 GN=yihQ PE=1 SV=3
sp|Q14697|GANAB_HUMAN	7.29e-06	448	730	494	770	Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000337	0.999637	CS pos: 24-25. Pr: 0.9706

TMHMM  Annotations     

There is no transmembrane helices in PPTG_03687-t26_1-p1.