CAZyme Information: PPTG_03642-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_03642-t26_1-p1
• CAZy Family: AA6
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
650	KI669564|CGC3	72603.13	7.5193

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669564:2371752-2373764(-)

Full Sequence      

MVAQTWNFGDSNQFFKSLFSHSPHDSPIIKTPQNNNSTWPVLFERLQQLDQLFQAWHEQL
RSFFTWQKYEPDARTRSQSEDITEVSDGSSSCEDGPGEHSTLRRRSRPRSKTLADCRLEV
NNSRKPVAEQTNVKDSQASIVCPSAMQICIMIVGTRGDVQPFLAIAKRLQQDGHRVRLAT
HKIYREFVTSHDVEFYPLGGDPKELAAYMVKTGGRLIPPLNLETLQKDVPRQMQILEDIL
MSTWPAVSAPDPDGKAPGVPGCPFTAQAIISNPVTYGHIHVAEKLGVPLHIMFPQPWVPT
VAFPHPMSNLPYQDKPQKRNYLSYKLVDLLMWEGMERLVNTFRSDVLGLPRIRKGGRGRE
MLQDLDIPHSFMWSPSLVPKPFDWGDLYDVVGTVTLKTEDSSYTPSPALEAFLGNGKGPV
FVGFGSMVLEDPLATSRMIIEAAKQANVKVLIQSSWTDMAGDLDVPDNVFFIGNCPHDWL
LARCSAVVHHGGAGTTAGGLLAGKPTFIVPFFGDQPFWGRAVVKAGVGVEPCPITELTTK
KLRDAFEELQSPFLRNRALRLQKRMQKENGAEEAVKSFYMHLPLRRSVDYAARGQELTNV
TRVTPTGAAVFLQEIGWTIACLNHVGGVVRDISQFLLLSCFTSWDVVPVR

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	272	576	4.4e-53	0.7146596858638743

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	2.53e-64	146	578	1	401	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	4.45e-35	146	577	2	394	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	6.65e-20	148	304	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
273616	MGT	6.87e-08	151	574	1	382	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ23942.1|GT1	1.46e-221	125	584	56	513
CCA24416.1|GT1	1.38e-195	145	584	66	504
CEF74027.1|GT1	5.66e-132	142	584	90	521
CEI65662.1|GT1	2.28e-131	142	584	91	522
CZS77295.1|GT1	3.12e-131	142	584	90	521

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	9.13e-73	150	618	24	476	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	1.52e-72	150	618	44	496	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
3H4I_A	1.30e-26	146	558	1	358	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1IIR_A	7.63e-24	146	529	1	347	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
1RRV_A	4.92e-21	146	558	1	376	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9M8Z7|U80A2_ARATH	2.25e-123	146	583	193	611	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q9XIG1|U80B1_ARATH	3.67e-122	146	583	156	575	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q6C8M8|ATG26_YARLI	1.03e-72	117	599	965	1430	Sterol 3-beta-glucosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ATG26 PE=3 SV=3
sp|Q4WID6|ATG26_ASPFU	1.14e-68	122	609	871	1343	Sterol 3-beta-glucosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=atg26 PE=3 SV=2
sp|A1CYS1|ATG26_NEOFI	1.57e-68	122	609	880	1352	Sterol 3-beta-glucosyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=atg26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000030	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PPTG_03642-t26_1-p1.