CAZyme Information: PPTG_03559-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_03559-t26_1-p1
• CAZy Family: AA6
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
457		48860.96	4.1471

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669564:1955481-1956854(+)

Full Sequence      

MRPVSRYVALLFTALSVSRSSAYSSDACQSILTGSYPGAVSAYPNLKDQIELVAQQQVAQ
WYTDRVSDVSSLAKSVVLPKCVENASTPTVIVYGLPQKDCAHGYSTAGSNANTNDYRAFL
QQLADSAGDREIVYILEPDAIGLLANNGCGNDKGYAANLGVAMDILSQNTNAELYLDVGY
WTLANDEQAAAVAKIVNAVDPDSRCKGISLNTSNYRSNAEMVATCERFVNATGRDYKCIV
DTSRNYVTGSSEWCNSEWAGIGEFPTSNTGSSVVSRYIWAKPPGESDGECSGQSNEALRG
PSAGTFFPDHFVKLWDNGVFVQKLRMSPINAANTTNNSTVPTPAPTTVQPSAVPTATPSI
DQVVQDITSLTVFDVDGDVVGQVNAGDEWEGGEDNQVTTTPATPKPTMSTPVLVEVEPPH
TMVVVDVVPDDEHADSDSDFTSVEEITESTIKHKACQ

Enzyme Prediction     

No EC number prediction in PPTG_03559-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH6	44	293	8.7e-55	0.9285714285714286

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396075	Glyco_hydro_6	1.08e-38	53	290	11	287	Glycosyl hydrolases family 6.
227616	CelA1	1.03e-15	79	347	178	462	Cellulase/cellobiase CelA1 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55493.1|GH6	4.55e-83	11	321	5	301
AIG55776.1|CBM1|GH6	1.07e-82	1	344	1	316
CCA20052.1|GH6	2.49e-82	35	321	4	301
AIG55492.1|GH6	4.73e-78	11	321	5	301
AIG55974.1|GH6	1.45e-76	28	330	26	325

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1UP3_A	6.18e-23	88	317	71	291	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with METHYL-CELLOBIOSYL-4-DEOXY-4-THIO-BETA-D-CELLOBIOSIDE at 1.6 angstrom [Mycobacterium tuberculosis H37Rv]
1UP0_A	6.18e-23	88	317	71	291	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with cellobiose at 1.75 angstrom [Mycobacterium tuberculosis H37Rv]
1UOZ_A	8.76e-23	88	317	92	312	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with thiocellopentaose at 1.1 angstrom [Mycobacterium tuberculosis H37Rv]
1UP2_A	1.15e-22	88	317	71	291	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with glucose-isofagomine at 1.9 angstrom [Mycobacterium tuberculosis H37Rv]
4I5R_A	9.17e-21	91	317	79	352	Crystal structure of a fungal chimeric cellobiohydrolase Cel6A [Humicola insolens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P26414|GUNA_THEBI	3.03e-26	88	288	102	301	Endoglucanase A OS=Thermobispora bispora OX=2006 GN=celA PE=3 SV=1
sp|A2QYR9|CBHC_ASPNC	7.87e-20	91	317	181	454	Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=cbhC PE=3 SV=1
sp|Q0CFP1|CBHC_ASPTN	8.29e-20	91	317	190	463	Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=cbhC PE=3 SV=1
sp|A1DJQ7|CBHC_NEOFI	2.42e-19	91	317	172	445	Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=cbhC PE=3 SV=1
sp|Q4WFK4|CBHC_ASPFU	3.34e-19	91	317	176	449	Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=cbhC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000241	0.999731	CS pos: 22-23. Pr: 0.9728

TMHMM  Annotations     

There is no transmembrane helices in PPTG_03559-t26_1-p1.