CAZyme Information: PPTG_03156-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_03156-t26_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
445		44975.51	4.0730

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669564:552420-553757(+)

Full Sequence      

MVSPLKYLVASSLVVSCVSAHGWLSKPAATFSNEAGDKSQFIATIEASSSGFKGTFNTAP
ADNVASFTKAFATSTYKSLKAFIDDKAKITVTGATLTCGNAEPDATAQPLPDKLEWYHSE
SEGFTASHEGPCEAWCDSERVFHDENCAANFKTAPAEMPYEKSKCSGASTLTFYWMAMHG
PTWQVYVNCAPLSGGSGGGATTQSSGSSATTTDSSSAQSPAAQTPSSGGSPSSPSTPTTD
SSSADTPSVTPAPASGGSPSTTPTSGGSPSVTPAPASGGSPSTSTTSAPSTPTTDESDCG
SYDVAGSDEDCGSYDVAGGSADEGQDTTQTSTGGNTYQQGSTTTGGNTYQQGSTNTGGNT
NQGSNTGGNTNQWSNTGGNTNQWSNTGGNTNQWSNTGGNTNQWSNTGTGSQQNPYQGTGA
GSQNSFDFNTFQGTTNAGTVAPQYM

Enzyme Prediction     

No EC number prediction in PPTG_03156-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA17	13	261	5.4e-67	0.9183673469387755

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
411053	dermokine	0.001	305	431	240	365	dermokine. Dermokine, also known as epidermis-specific secreted protein SK30/SK89, is a skin-specific glycoprotein that may play a regulatory role in the crosstalk between barrier dysfunction and inflammation, and therefore play a role in inflammatory diseases such as psoriasis. Dermokine is one of the most highly expressed proteins in differentiating keratinocytes, found mainly in the spinous and granular layers of the epidermis, but also in the epithelia of the small intestine, macrophages of the lung, and endothelial cells of the lung. Mouse dermokine has been reported to be encoded by 22 exons, and its expression leads to alpha, beta, and gamma transcripts.
411053	dermokine	0.003	312	433	212	337	dermokine. Dermokine, also known as epidermis-specific secreted protein SK30/SK89, is a skin-specific glycoprotein that may play a regulatory role in the crosstalk between barrier dysfunction and inflammation, and therefore play a role in inflammatory diseases such as psoriasis. Dermokine is one of the most highly expressed proteins in differentiating keratinocytes, found mainly in the spinous and granular layers of the epidermis, but also in the epithelia of the small intestine, macrophages of the lung, and endothelial cells of the lung. Mouse dermokine has been reported to be encoded by 22 exons, and its expression leads to alpha, beta, and gamma transcripts.
236090	PRK07764	0.008	217	276	432	491	DNA polymerase III subunits gamma and tau; Validated
411418	ser_rich_anae_1	0.009	324	442	288	399	serine-rich protein. This serine-rich protein belongs to a family with large size (over 1000 amino acids), which a highly serine-rich central region that averages over 300 aa in length. Species encoding members of this family of proteins tend to be anaerobic bacteria, including Gram-positive bacteria of the human gut microbiome and Chloroflexi from marine sediments.
411418	ser_rich_anae_1	0.009	320	426	290	397	serine-rich protein. This serine-rich protein belongs to a family with large size (over 1000 amino acids), which a highly serine-rich central region that averages over 300 aa in length. Species encoding members of this family of proteins tend to be anaerobic bacteria, including Gram-positive bacteria of the human gut microbiome and Chloroflexi from marine sediments.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ETN20068.1|AA17	9.20e-154	1	445	1	445
ETI41700.1|AA17	4.00e-150	1	445	1	435
ETP39568.1|AA17	3.43e-149	1	445	13	447
ETM41632.1|AA17	4.87e-149	1	445	13	447
ETP11442.1|AA17	1.31e-148	1	445	1	435

PDB Hits     

PPTG_03156-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

PPTG_03156-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000521	0.999434	CS pos: 20-21. Pr: 0.9661

TMHMM  Annotations     

There is no transmembrane helices in PPTG_03156-t26_1-p1.