CAZyme Information: PPTG_03153-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_03153-t26_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
314		32180.59	4.6568

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669564:538996-539940(+)

Full Sequence      

MISPVKCLLTSALLATCANAHGWLTKPAAVYDTQMDKSQYIGTIESTTSGFKGTFTGAPA
DNVAAFTKAFESSKYKSLKAVIDDKAKIIVPGATLTCGIADPKATPQPLPAKVEWYHSES
EGFTATHEGPCEVWCDKERVFHDDNCAAHYTAAPAELPYEKSKCTGASFLTMYWVAMHGP
SWQVYVNCAPLSGGSGGGATTESSGSSATTTDASAAEAPVAQTPPSEESPSAPTTDSSSA
DTPSVTPAPAPEGSQSVTPAPASEDSTSVTPAPASGDSPPATPAPDSGDLPSVTPVPASG
DSPSTSNCKVRKRK

Enzyme Prediction     

No EC number prediction in PPTG_03153-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA17	13	261	2.1e-75	0.9346938775510204

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235906	PRK07003	5.54e-07	189	306	396	515	DNA polymerase III subunit gamma/tau.
237874	PRK14971	2.09e-06	219	307	386	472	DNA polymerase III subunit gamma/tau.
411474	fibronec_FbpA	2.30e-06	200	305	132	242	LPXTG-anchored fibronectin-binding protein FbpA. FbpA, a fibronectin-binding protein described in Streptococcus pyogenes, has a YSIRK-type (crosswall-targeting) signal peptide and a C-terminal LPXTG motif for covalent attachment to the cell wall. It is unrelated to the PavA-like protein from Streptococcus gordonii (see BlastRule NBR009716) that was given the identical name, so the phase LPXTG-anchored is added to the protein name for clarity.
236090	PRK07764	2.51e-06	189	298	649	758	DNA polymerase III subunits gamma and tau; Validated
236090	PRK07764	3.22e-06	203	303	396	494	DNA polymerase III subunits gamma and tau; Validated

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ETN20064.1|AA17	2.09e-166	1	314	1	314
ETO70341.1|AA17	4.10e-137	35	314	1	280
ETK81741.1|AA17	1.99e-136	35	256	1	222
ETM41632.1|AA17	6.66e-106	1	222	13	235
ETI41700.1|AA17	1.05e-104	1	223	1	224

PDB Hits     

PPTG_03153-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

PPTG_03153-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000796	0.999156	CS pos: 20-21. Pr: 0.9482

TMHMM  Annotations     

There is no transmembrane helices in PPTG_03153-t26_1-p1.