CAZyme Information: PPTG_03053-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_03053-t26_1-p1
• CAZy Family: AA17
• CAZyme Description: NAD(P)H:quinone oxidoreductase, type IV

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
225	KI669564|CGC5	24177.19	9.6037

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669564:233912-234589(-)

Full Sequence      

MRPPHYSIYPTPTTSTIFRSPTPTKMTKVAIVFYSTFGHVTKMASAIQKGIQTVPGVQAQ
LYQVKETLNEEVLAKLHAPPKPDFPIATPDVLKNADGIMLGFPTHFGMVPAQMKALFDAS
VALWVKGELIGKPCGIFFSCGSRGGGQEVSAMSTTPYIAHLGMLFVPLALNGKTIEGSDE
MHGCSLWGSGTVAGHDRSRQPSALELKVAEMQGKKFAEITKKLAA

Enzyme Prediction     

No EC number prediction in PPTG_03053-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA6	28	222	8.6e-70	0.9948717948717949

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
179647	PRK03767	2.35e-64	26	225	1	200	NAD(P)H:quinone oxidoreductase; Provisional
130816	flav_wrbA	1.26e-58	27	223	1	197	NAD(P)H:quinone oxidoreductase, type IV. This model represents a protein, WrbA, related to and slightly larger than flavodoxin. It was just shown, in E. coli and Archaeoglobus fulgidus (and previously for some eukaryotic homologs) to act as fourth type of NAD(P)H:quinone oxidoreductase. In E. coli, this protein was earlier reported to be produced during stationary phase, bind to the trp repressor, and make trp operon repression more efficient. WrbA does not interact with the trp operator by itself. Members are found in species in which homologs of the E. coli trp operon repressor TrpR (SP:P03032) are not detected. [Energy metabolism, Electron transport]
223728	WrbA	4.65e-43	24	223	1	205	Multimeric flavodoxin WrbA [Energy production and conversion].
397438	FMN_red	9.57e-11	92	167	67	140	NADPH-dependent FMN reductase.
396879	Flavodoxin_2	8.45e-05	58	142	29	130	Flavodoxin-like fold. This family consists of a domain with a flavodoxin-like fold. The family includes bacterial and eukaryotic NAD(P)H dehydrogenase (quinone) EC:1.6.99.2. These enzymes catalyze the NAD(P)H-dependent two-electron reductions of quinones and protect cells against damage by free radicals and reactive oxygen species. This enzyme uses a FAD co-factor. The equation for this reaction is:- NAD(P)H + acceptor <=> NAD(P)(+) + reduced acceptor. This enzyme is also involved in the bioactivation of prodrugs used in chemotherapy. The family also includes acyl carrier protein phosphodiesterase EC:3.1.4.14. This enzyme converts holo-ACP to apo-ACP by hydrolytic cleavage of the phosphopantetheine residue from ACP. This family is related to pfam03358 and pfam00258.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BDA46620.1|AA6	2.65e-65	23	225	41	245
BAA22940.1|AA6	4.34e-64	28	225	4	201
ACF86423.1|AA6	6.55e-64	28	223	4	199
BDA46621.1|AA6	3.69e-63	28	225	49	247
CDM84515.1|AA6	3.75e-63	28	223	4	199

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MP4_A	5.78e-57	26	222	1	197	The structure of Pst2p from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C],5MP4_B The structure of Pst2p from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C],5MP4_C The structure of Pst2p from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C],5MP4_D The structure of Pst2p from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C],5MP4_E The structure of Pst2p from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C],5MP4_F The structure of Pst2p from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C],5MP4_G The structure of Pst2p from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C],5MP4_H The structure of Pst2p from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C]
4LA4_A	1.58e-42	27	224	3	204	Crystal structure of native PnpB [Pseudomonas sp. WBC-3],4LA4_B Crystal structure of native PnpB [Pseudomonas sp. WBC-3],4LAF_A Crystal structure of PnpB complex with FMN [Pseudomonas sp. WBC-3],4LAF_B Crystal structure of PnpB complex with FMN [Pseudomonas sp. WBC-3],4LAF_C Crystal structure of PnpB complex with FMN [Pseudomonas sp. WBC-3],4LAF_D Crystal structure of PnpB complex with FMN [Pseudomonas sp. WBC-3]
2R96_A	7.72e-38	26	223	1	196	Crystal structure of E. coli WrbA in complex with FMN [Escherichia coli],2R96_C Crystal structure of E. coli WrbA in complex with FMN [Escherichia coli],2R97_A Crystal structure of E. coli WrbA in complex with FMN [Escherichia coli],2R97_C Crystal structure of E. coli WrbA in complex with FMN [Escherichia coli],2RG1_A Crystal structure of E. coli WrbA apoprotein [Escherichia coli],2RG1_B Crystal structure of E. coli WrbA apoprotein [Escherichia coli],3B6I_A WrbA from Escherichia coli, native structure [Escherichia coli K-12],3B6I_B WrbA from Escherichia coli, native structure [Escherichia coli K-12],3B6J_A WrbA from Escherichia coli, NADH complex [Escherichia coli K-12],3B6J_B WrbA from Escherichia coli, NADH complex [Escherichia coli K-12],3B6K_A WrbA from Escherichia coli, Benzoquinone complex [Escherichia coli K-12],3B6K_B WrbA from Escherichia coli, Benzoquinone complex [Escherichia coli K-12],3B6M_A WrbA from Escherichia coli, second crystal form [Escherichia coli K-12],3B6M_B WrbA from Escherichia coli, second crystal form [Escherichia coli K-12]
5F4B_A	8.63e-38	26	223	4	200	Structure of B. abortus WrbA-related protein A (WrpA) [Brucella abortus 2308],5F4B_B Structure of B. abortus WrbA-related protein A (WrpA) [Brucella abortus 2308]
5F51_A	1.37e-37	26	223	21	217	Structure of B. abortus WrbA-related protein A (apo) [Brucella abortus 2308]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9AYU0|QR2_TRIVS	5.75e-63	27	223	3	200	Quinone-oxidoreductase QR2 OS=Triphysaria versicolor OX=64093 PE=1 SV=1
sp|Q9LSQ5|FQR1_ARATH	2.58e-61	27	223	3	199	NAD(P)H dehydrogenase (quinone) FQR1 OS=Arabidopsis thaliana OX=3702 GN=FQR1 PE=1 SV=1
sp|Q6NQE2|FQRL1_ARATH	7.57e-61	27	223	3	199	Probable NAD(P)H dehydrogenase (quinone) FQR1-like 1 OS=Arabidopsis thaliana OX=3702 GN=At4g27270 PE=1 SV=1
sp|P25349|YCP4_YEAST	2.04e-57	26	223	1	200	Flavoprotein-like protein YCP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YCP4 PE=1 SV=1
sp|Q12335|PST2_YEAST	2.97e-56	26	222	1	197	Protoplast secreted protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PST2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PPTG_03053-t26_1-p1.