CAZyme Information: PPTG_02889-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_02889-t26_1-p1
• CAZy Family: AA17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
586		61842.08	4.5870

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669562:2597570-2599330(+)

Full Sequence      

MMNIWNRAGRDGVRALFMLVTASHKSLPCSSLVRTTQHHRRSSIGSCSPLAFSCPTGALQ
SSLSLSLSPSEPVDQQPLFQAKVLVTTMKFFAPIVVGFIAFFSTQVDANGVCYDPDHTSG
KSASTVQADMKTIAGAGFTSVRTYISKFGDTEMGSIITGAGLTAVLGVPYPQSDYQEQME
AAIKAANAGGVYAIMVGNENLAGASSIPSGMIDVINQIKSRVSCKVGTVQRNTEVINYQS
ISGWSELVAACDVLGVNVHPFFNPGTTADGAIDVVDKQWQTMMSNFGDKLLLTETGWPSS
GSVSGNTGSLAGEQTFYSAYQKWSSGLSEKFYFQFFDIPSKPEAYEQTFGLYTADSQPKF
TMSQQQSSSTPTSQQQTPSTPTSQQQQQPTTSAPTTAAPAPTTAAPTPEQTNAPEPGAST
PTPTPETYQSSGASETNTNTTSSISSHSGSVLSGSDETGVPSGNSAEKDAASTKQDDTKT
DSKSDKTSETTQSTATISSIGKSSESQQEQQTSSNNQDNTTQQVNNQSEESGSKDSVVGL
AVGGGACAMLVAFGFIYQARKRAQELDEDKDVHFSTVTPVENICSL

Enzyme Prediction     

No EC number prediction in PPTG_02889-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	110	363	1.8e-18	0.9903536977491961

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	5.16e-20	110	355	47	304	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	1.22e-06	110	360	2	305	Glycosyl hydrolases family 17.
411220	elast_bind_EbpS	4.11e-04	453	533	305	389	elastin-binding protein EbpS. The elastin-binding protein EbpS is an adhesin described in Staphylococcus aureus, with orthologs found in many additional staphylococcal species. EbpS is a membrane protein that lacks an N-terminal signal peptide region, has extensive regions low-complexity sequence rich in Asn and Gln, and has a C-terminal LysM domain.
381626	GH113_mannanase-like	6.84e-04	173	299	108	233	Glycoside hydrolase family 113 beta-1,4-mannanase and similar proteins. Mannan endo-1,4-beta mannosidase (E.C 3.2.1.78) randomly cleaves (1->4)-beta-D-mannosidic linkages in mannans, galactomannans and glucomannans and is also called beta-1,4-mannanase, endo-1,4-beta-mannanase, endo-beta-1,4-mannase, beta-mannanase B, beta-1, 4-mannan 4-mannanohydrolase, endo-beta-mannanase, beta-D-mannanase, 1,4-beta-D-mannan mannanohydrolase, and 4-beta-D-mannan mannanohydrolase. (1->4)-beta-linked mannans are polysaccharides with a linear polymer backbone of (1->4)-beta-linked mannose units (in plants and fungi) or alternating mannose and glucose/galactose units (glucomannan in plants and fungi, and galactomannan and galactoglucomannan in plants), such as in the hemicellulose fraction of hard- and softwoods. Complete degradation of mannan requires a series of enzymes, including beta-1,4-mannanase. According to the CAZy database beta-1,4-mannanases are grouped into various glycoside hydrolase (GH) families; GH family 113 beta-1,4-mannanases include mostly bacterial and archaeal sequences.
411220	elast_bind_EbpS	0.001	462	534	334	415	elastin-binding protein EbpS. The elastin-binding protein EbpS is an adhesin described in Staphylococcus aureus, with orthologs found in many additional staphylococcal species. EbpS is a membrane protein that lacks an N-terminal signal peptide region, has extensive regions low-complexity sequence rich in Asn and Gln, and has a C-terminal LysM domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ24978.1|GH17	1.85e-122	88	357	1	272
AIG55724.1|GH17	1.85e-22	140	359	65	311
AIG55417.1|GH17	2.12e-22	138	360	51	278
UPT50359.1|GH17	2.12e-22	110	355	29	280
AIG55926.1|CBM13|GH17	3.25e-22	97	360	10	272

PDB Hits     

PPTG_02889-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8MXP5|BTGE_ASPFN	1.37e-14	110	305	348	549	Probable beta-glucosidase btgE OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=btgE PE=3 SV=1
sp|Q2US39|BTGE_ASPOR	1.37e-14	110	305	348	549	Probable beta-glucosidase btgE OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=btgE PE=3 SV=1
sp|A1DBG6|BTGE_NEOFI	3.80e-14	110	346	297	540	Probable beta-glucosidase btgE OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=btgE PE=3 SV=1
sp|B0Y9Q9|BTGE_ASPFC	5.17e-14	110	305	310	512	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgE PE=3 SV=2
sp|Q4WC60|BTGE_ASPFU	5.17e-14	110	305	310	512	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgE PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000005

TMHMM  Annotations     

Start	End
537	556