CAZyme Information: PPTG_02702-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_02702-t26_1-p1
• CAZy Family: AA17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
527		59912.71	8.7070

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669562:2096475-2098467(-)

Full Sequence      

MSAGTQSSLLQRGLQFLEENDEKRAGMWLVWLFLILVRWMVGLHSYSGEHTPPMFGDYEA
QRHWMEITINLPISGWYFNTTSNDLLYWGLDYPPLTAYVSYLFGRAASVMEPAMVELTNS
RGYESAASKVFMRSSVLLCDIALFIPAILYMARALYGNEQWRRRTTFVLLILLQPAILLI
DHGHFQYNNVCLGFTALGVALILQGHEFLGSICYCLALNFKQMALYYAPSFGVFLLARCL
YRKMCVLHLLKLAVAVIATFALMWSPFCAYPSQEETCLSTIAQVVQRIFPFGRGLFEDKV
ANFWCIVDFVLKIRRHVTPALQMRLCTAMTFIGFLPSIIDLLRRKPTNLRFVLSLAICSL
SFFLFSFQVHEKTILLPLLPISFLFAHNALLSGWFSVLSTFSMYFLLKKDGLVLPYIVLQ
LAYVGVAVAPFLTSGTSKHLHVQQSDVAPGYKQDGSAHPLFRAYVMLSLLGIIVIHAAQV
WITPPARYPHIHDYVFAAYSCGHFLLVLGYLTYWQWTAGTQCKTKKE

Enzyme Prediction     

EC	2.4.1.267:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT57	35	509	1.6e-141	0.9896049896049897

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397324	Alg6_Alg8	1.63e-164	52	506	9	471	ALG6, ALG8 glycosyltransferase family. N-linked (asparagine-linked) glycosylation of proteins is mediated by a highly conserved pathway in eukaryotes, in which a lipid (dolichol phosphate)-linked oligosaccharide is assembled at the endoplasmic reticulum membrane prior to the transfer of the oligosaccharide moiety to the target asparagine residues. This oligosaccharide is composed of Glc(3)Man(9)GlcNAc(2). The addition of the three glucose residues is the final series of steps in the synthesis of the oligosaccharide precursor. Alg6 transfers the first glucose residue, and Alg8 transfers the second one. In the human alg6 gene, a C->T transition, which causes Ala333 to be replaced with Val, has been identified as the cause of a congenital disorder of glycosylation, designated as type Ic OMIM:603147.
227937	COG5650	0.009	141	267	178	291	Uncharacterized membrane protein [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ20779.1|GT57	1.67e-271	1	527	1	589
CCA15270.1|GT57	3.15e-193	15	517	14	520
CAG31431.1|GT57	1.07e-128	22	510	2	488
CAD60191.1|GT57	1.07e-128	22	510	2	488
AAH77552.1|GT57	3.00e-122	32	526	12	505

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SNH_X	4.63e-102	28	489	58	525	Cryo-EM structure of yeast ALG6 in complex with 6AG9 Fab and Dol25-P-Glc [Saccharomyces cerevisiae],6SNI_X Cryo-EM structure of nanodisc reconstituted yeast ALG6 in complex with 6AG9 Fab [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q802T2|ALG6_CHICK	1.90e-129	22	510	2	488	Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Gallus gallus OX=9031 GN=ALG6 PE=2 SV=1
sp|Q54QG6|ALG6_DICDI	7.73e-123	29	510	20	502	Probable dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Dictyostelium discoideum OX=44689 GN=alg6 PE=3 SV=1
sp|Q9Y672|ALG6_HUMAN	3.48e-115	22	510	2	488	Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Homo sapiens OX=9606 GN=ALG6 PE=1 SV=2
sp|Q3TAE8|ALG6_MOUSE	1.38e-114	22	510	2	488	Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Mus musculus OX=10090 GN=Alg6 PE=2 SV=1
sp|Q5NVS8|ALG6_PONAB	3.89e-114	22	510	2	488	Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Pongo abelii OX=9601 GN=ALG6 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000027	0.000011

TMHMM  Annotations     

Start	End
25	42
130	152
165	184
194	216
245	267
320	342
349	368
383	405
412	434
460	482
495	517