CAZyme Information: PPTG_02510-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_02510-t26_1-p1
• CAZy Family: AA17
• CAZyme Description: hypothetical protein, variant

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
945	KI669562|CGC2	106820.71	5.0804

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

Full Sequence      

MAAPVWVLCCSVCVAIVAALSPGFNDPMPYYTLPLLEILHPQNDMMMADTELQVEIEVRS
ELLSSGLRRSRVCIVMQPAYVPPDVVLDSGAGEVDESCFDQSLNYTTFHVAGLVPGLSYA
LTVGLENDGNMVALSTRTFSVGSILLPGVDDRLSVADALEAGAELHKAQERETASGIYRY
VLAIFPDHGPAQHLLGLALYQDGKLHEALSLLYRAVQSNESEENFHNSLGICLKSLGRIN
EAIKHYRRAIELNPMQVQAAVNLGDAMQSKGKWEEAFKEYSKVANTPMSLLYSQLEPTKA
EHVAKDATGRLCELIRVTDGWYRADRCLNEALERWPDEPVFHNDRGNLLANAGQFETALN
EYQRSSELGLLAGTLNLAETLEALGETQKSIDLYDQVLGSEIFDRFHPRTRIMVMKATVL
PRVLPSSQKEIDAYRDRFEREVEALLHNLDSLETTEVDPNRISLSTAITLTAHNRNNREL
KAAMGQLYWQLLYRRQLMLEDYVASYGIIPLPYTQQIEDVKRPEIGPQRLRVGFVSRYIF
NSAVGLYMSELIPKFNRDKYEIVVFAIGQSKSMKVAKEIDAVTETIVALPKDMRIVREEI
RAWKMDVLIYPELGMDKTTYFVSLARLAPVQAVWWGNADTSGVPTMDYYLTSEHEHKTAN
SHYSEAIYKFKGMGIYHKLPALPKRDINRGQVRKAIEERFDISPDFHFYLAIESIIHIHP
DFDAAVAKLFEKDKKAHLFLLSTSSRKIWKSQLQARMESAGVDPDRLHFLTDVDQKQESM
LMRAADAVIASLHLTRPRASLQAFAAGVPVVTFPNELWASRITFGFYQQMGINDLIAASL
DEYVALAVKLATDSAFHKEMVQLIKRNRSKLSEDEEAVREWEKFFDFAADQIFPSGELES
FIPKSESDWGSPQQLKEIQIDWSEAKGLEEWNQAEGWRLRADEDE

Enzyme Prediction     

No EC number prediction in PPTG_02510-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT41	310	886	7.7e-69	0.5404255319148936

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226428	Spy	2.44e-30	527	885	257	611	Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones].
276809	TPR	1.32e-17	191	283	3	95	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
276809	TPR	9.02e-14	159	251	5	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
411346	social_mot_Tgl	3.79e-13	195	285	37	128	social motility TPR repeat lipoprotein Tgl. Social motility in delta-proteobacterial species such as Myxococcus xanthus depends on a type VI pilus, which in turn depends on assembly of the PilQ secretin complex. Tgl, a tetratricopeptide repeat (TPR) outer membrane lipoprotein, is required for PilQ assembly.
223533	TPR	7.13e-09	156	283	131	262	Tetratricopeptide (TPR) repeat [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ20641.1|GT41	UIZ20641.1|GT41	0.0	17	933	19	944
BAZ61948.1|GT41	BAZ61948.1|GT41	1.59e-65	333	888	365	884
BAZ15802.1|GT41	BAZ15802.1|GT41	1.59e-65	333	888	365	884
BBO66743.1|GT41	BBO66743.1|GT41	5.06e-59	414	886	458	899
BBO73735.1|GT41	BBO73735.1|GT41	1.75e-58	414	888	374	814

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VSN_A	2VSN_A	5.81e-09	626	855	304	524	Structure and topological arrangement of an O-GlcNAc transferase homolog: insight into molecular control of intracellular glycosylation [Xanthomonas campestris pv. campestris str. 8004],2VSN_B Structure and topological arrangement of an O-GlcNAc transferase homolog: insight into molecular control of intracellular glycosylation [Xanthomonas campestris pv. campestris str. 8004]
2JLB_A	2JLB_A	5.81e-09	626	855	304	524	Xanthomonas campestris putative OGT (XCC0866), complex with UDP- GlcNAc phosphonate analogue [Xanthomonas campestris pv. campestris],2JLB_B Xanthomonas campestris putative OGT (XCC0866), complex with UDP- GlcNAc phosphonate analogue [Xanthomonas campestris pv. campestris],2VSY_A Xanthomonas campestris putative OGT (XCC0866), apostructure [Xanthomonas campestris pv. campestris str. ATCC 33913],2VSY_B Xanthomonas campestris putative OGT (XCC0866), apostructure [Xanthomonas campestris pv. campestris str. ATCC 33913],2XGM_A Substrate and product analogues as human O-GlcNAc transferase inhibitors. [Xanthomonas campestris],2XGM_B Substrate and product analogues as human O-GlcNAc transferase inhibitors. [Xanthomonas campestris],2XGO_A XcOGT in complex with UDP-S-GlcNAc [Xanthomonas campestris],2XGO_B XcOGT in complex with UDP-S-GlcNAc [Xanthomonas campestris],2XGS_A XcOGT in complex with C-UDP [Xanthomonas campestris],2XGS_B XcOGT in complex with C-UDP [Xanthomonas campestris]
6Q4M_A	6Q4M_A	2.36e-07	507	860	218	675	Crystal structure of the O-GlcNAc transferase Asn648Tyr mutation [Homo sapiens]
5HGV_A	5HGV_A	2.10e-06	507	860	214	671	Structure of an O-GlcNAc transferase point mutant, D554N in complex with peptide [Homo sapiens],5HGV_C Structure of an O-GlcNAc transferase point mutant, D554N in complex with peptide [Homo sapiens]
5NPS_A	5NPS_A	2.75e-06	507	860	213	670	The human O-GlcNAc transferase in complex with a bisubstrate inhibitor [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9M8Y0|SEC_ARATH	sp|Q9M8Y0|SEC_ARATH	3.84e-10	504	868	568	929	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana OX=3702 GN=SEC PE=1 SV=1
sp|O82039|SPY_PETHY	sp|O82039|SPY_PETHY	5.09e-08	518	853	479	808	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Petunia hybrida OX=4102 GN=SPY PE=2 SV=1
sp|Q6YZI0|SPY_ORYSJ	sp|Q6YZI0|SPY_ORYSJ	1.51e-07	523	860	467	801	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Oryza sativa subsp. japonica OX=39947 GN=SPY PE=2 SV=1
sp|Q8RVB2|SPY_SOLLC	sp|Q8RVB2|SPY_SOLLC	2.61e-07	527	853	484	808	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Solanum lycopersicum OX=4081 GN=SPY PE=2 SV=1
sp|O82422|SPY_HORVU	sp|O82422|SPY_HORVU	2.62e-07	523	860	467	801	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Hordeum vulgare OX=4513 GN=SPY PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000217	0.999716	CS pos: 19-20. Pr: 0.9495

TMHMM  Annotations     

Start	End
5	24