CAZyme Information: PPTG_02261-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_02261-t26_1-p1
• CAZy Family: AA17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
672		76765.36	6.1302

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669562:644139-646157(+)

Full Sequence      

MALYGSIPVLVAPNKVNTVGMFWNNPTETFIDIWTNKEANSKSSHWISESGVFDLFLLAG
PSSADLFSQYTHLTGRAQLPPLFALGYHQSRWNYKNEADVARVNAGFDEHLIPYDVLWLD
IDHTDGRRYFTWVEHGFPTPKDMQESLARTGRKTVTIVDPHIKVSQPKDKQPYYIHSEAE
ELGLFIKDEEGNDFKGWCWPGESSYVDFTSPKARAWWRHQFRYENYQGSTNHLYTWNDMN
EPSVFNGPEVSMRKGCTSLAGVEHREWHNLYGILFQRTTMEGQLIRQQPPPEPLSAFAEE
LQLTADMQRPFVLSRAFSAGSQRYGAIWTGDNTAEWGHLRYATKMLLSMSVVGLTFVGAD
VGGFFGSSSTELLTRWNQAATYQPFVRGHSHQDSARREPWVFGEPTTSRIRAAIRERYAL
LPYIYTLFHTCYATGMPVMRPLWAHFTQEPQSFIEEDQYLLGDALLVKPIVEKGVEATHV
FLPTDGAKDTTVWYQVTDGYKRFFGGKTYENVPALLDTIPVFHRGGTIPSRKQRVRRSSE
LMHNDPLTLVVALDQHFEARGELYVDDERSLAAELEGEGTVVSFQQTKEGLRSTATAATP
QGKRYRSLMWVERIVVYGFQSEANLPKQVLVGSERALDFQYDAVGDRLVLRKPQVLVTDD
WELHFVYDQALE

Enzyme Prediction     

EC	3.2.1.20:27	3.2.1.84:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	56	528	9.1e-142	0.9929742388758782

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395838	Glyco_hydro_31	0.0	56	528	1	441	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
269889	GH31_GANC_GANAB_alpha	0.0	75	570	1	467	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.
224418	YicI	2.16e-154	3	567	190	706	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
269890	GH31_glucosidase_II_MalA	8.29e-136	75	435	1	339	Alpha-glucosidase II-like. Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities. Alpha-glucosidase II has been characterized in Bacillus thermoamyloliquefaciens where it forms a homohexamer. This subgroup also includes the MalA alpha-glucosidase from Sulfolobus solfataricus and the AglA alpha-glucosidase from Picrophilus torridus. MalA is part of the carbohydrate-metabolizing machinery that allows this organism to utilize carbohydrates, such as maltose, as the sole carbon and energy source.
215408	PLN02763	9.69e-105	61	567	164	632	hydrolase, hydrolyzing O-glycosyl compounds

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ21254.1|GH31	0.0	1	672	348	1019
CCA25893.1|GH31	5.99e-282	1	668	333	1006
AFO95770.1|GH31	4.45e-226	1	663	317	965
ACI64826.1|GH31	1.07e-224	1	663	201	855
AFJ50183.1|GH31	4.22e-224	1	663	296	944

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F0E_A	5.25e-220	1	664	225	855	Murine endoplasmic reticulum alpha-glucosidase II [Mus musculus],5H9O_A Complex of Murine endoplasmic reticulum alpha-glucosidase II with D-Glucose [Mus musculus],5H9O_C Complex of Murine endoplasmic reticulum alpha-glucosidase II with D-Glucose [Mus musculus],5HJO_A Murine endoplasmic reticulum alpha-glucosidase II with bound substrate analogue [Mus musculus],5HJO_C Murine endoplasmic reticulum alpha-glucosidase II with bound substrate analogue [Mus musculus],5HJR_A Murine endoplasmic reticulum alpha-glucosidase II with bound covalent intermediate [Mus musculus],5HJR_C Murine endoplasmic reticulum alpha-glucosidase II with bound covalent intermediate [Mus musculus]
5IEF_A	1.37e-217	1	664	261	910	Murine endoplasmic reticulum alpha-glucosidase II with N-butyl-1-deoxynojirimycin [Mus musculus]
5IEG_A	1.41e-217	1	664	261	910	Murine endoplasmic reticulum alpha-glucosidase II with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]
5IED_A	2.61e-217	1	664	283	932	Murine endoplasmic reticulum alpha-glucosidase II with castanospermine [Mus musculus],5IEE_A Murine endoplasmic reticulum alpha-glucosidase II with 1-deoxynojirimycin [Mus musculus]
7KRY_A	4.95e-217	1	664	292	941	Chain A, Neutral alpha-glucosidase AB [Mus musculus],7KRY_C Chain C, Neutral alpha-glucosidase AB [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q94502|GANAB_DICDI	3.75e-224	1	661	306	938	Neutral alpha-glucosidase AB OS=Dictyostelium discoideum OX=44689 GN=modA PE=3 SV=1
sp|P79403|GANAB_PIG	1.12e-220	1	664	293	942	Neutral alpha-glucosidase AB OS=Sus scrofa OX=9823 GN=GANAB PE=1 SV=1
sp|Q4R4N7|GANAB_MACFA	1.58e-220	1	664	293	942	Neutral alpha-glucosidase AB OS=Macaca fascicularis OX=9541 GN=GANAB PE=2 SV=1
sp|Q14697|GANAB_HUMAN	3.17e-220	1	664	293	942	Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB PE=1 SV=3
sp|Q8BHN3|GANAB_MOUSE	1.83e-216	1	664	293	942	Neutral alpha-glucosidase AB OS=Mus musculus OX=10090 GN=Ganab PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999054	0.000983

TMHMM  Annotations     

There is no transmembrane helices in PPTG_02261-t26_1-p1.