CAZyme Information: PPTG_01939-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_01939-t26_1-p1
• CAZy Family: AA17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
750		83275.33	5.8177

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669563:2510739-2512991(-)

Full Sequence      

MLVGSRLKTAAALCALLAVALQPSVSSAGVEPNFRQSIVSMDVPEGGEDSHDDPTDAPPA
PPAPEAPTDAPTPKPKSDSGPHDTEDRPDYEWYWKHGEASMFAQDSGIFKSFTPNDTDMT
CSLDTHATPFNSQVRGVNLGGWLVLEPWITPTLFYQFLNTQQRFGDKAPEKTAMDMYTFC
TALGKEEANRQLRIHYDNWVTEKDIAELAAAGINSLRVPVGDWMFNPYEPFAGCTDGAVD
ALDRVADLALKYGLEILLDIHGLIGSQNGFDNSGKSSNVKWTSIASTQPVGTTTFEHWPI
RQAEWAGTFDVENHNYSSINYANLNHSIVAVEAIINRYKDNKAIMGLEPVNEPWELTPIK
VLKQYYWKSYKRVKVLAPSWKFVIHDSFRFGLQFWAKFLKGCPDIALDTHIYQAWNPPGT
VADFFSNACQQKYVISDMENAMMPVIVGEWSVGTDNCAMWLNGFNDNLPGFPKVQCHMID
CPINSTYLGDGFPGTPLDKTKPIQGPYGTGMSGPSFGKCPITSKDSFNQDDDAALTKSLT
LKKLNGFANGHGWYFWNFKTEFATKWSFLDLVRLGAFPKNVSDYHESDGVERACMKEDRG
EFVCRAKRGVKEFELKSGLAFACNFPEIDCSDIKTRFLTLEEQCDWAFNEYWHLNRQKGA
TCDFGGAGHLLTEPGAAPTKLPEPVPVPLHKVKEEKPGHLLVSVAKWSIAAILGVIALAL
AAIAGAIFAVVRWRQTRMRRHYSPIGGNRA

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	191	468	4.5e-175	0.9964028776978417

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	6.58e-28	134	579	18	383	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
197867	X8	3.02e-15	604	670	3	73	Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges.
400371	X8	1.18e-11	604	669	3	76	X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains.
395098	Cellulase	0.008	195	286	15	115	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAM18483.1|CBM43|GH5_33	0.0	1	747	1	743
EGZ13975.1|CBM43|GH5_33	0.0	1	746	1	694
UIZ25536.1|CBM43|GH5_33	0.0	16	747	9	729
UIZ25532.1|CBM43|GH5_33	0.0	44	747	3	702
EEY56664.1|GH5_33	0.0	1	620	1	617

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	9.22e-51	131	583	6	384	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
1CZ1_A	3.31e-50	131	583	6	384	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	3.81e-50	131	583	12	390	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
3O6A_A	7.04e-50	131	583	11	389	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
2PBO_A	9.92e-50	131	583	12	390	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q96V64|EXG_BLUGR	1.03e-55	127	579	29	405	Glucan 1,3-beta-glucosidase OS=Blumeria graminis OX=34373 PE=3 SV=1
sp|Q5B5X8|EXGA_EMENI	1.41e-52	125	583	20	396	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2
sp|A2RAR6|EXGA_ASPNC	1.83e-52	130	583	37	408	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
sp|P29717|EXG1_CANAL	1.31e-49	131	583	50	428	Glucan 1,3-beta-glucosidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=XOG1 PE=1 SV=5
sp|D4AJL7|EXG1_ARTBC	1.41e-49	134	579	34	401	Probable glucan 1,3-beta-glucosidase ARB_04467 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_04467 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000321	0.999668	CS pos: 28-29. Pr: 0.9706

TMHMM  Annotations     

Start	End
709	731