CAZyme Information: PPTG_01363-t26_2-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_01363-t26_2-p1
• CAZy Family: AA17
• CAZyme Description: hypothetical protein, variant

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
328		37200.58	9.0359

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669563:630979-632374(-)

Full Sequence      

MSRRTLALFGGALVARLVLLLYGYFQDHYMAVKYTDVDYDVYSDAAREMAEGKSPFERTT
YRYTPVLAFLLLPNIYVHEVFGKLLFVGCDILVGYILYQILRLRGLPDASAVNYCCVWLF
HPFSVNISTRGNADAIVVLLVMLSLLLVMRKQLVLSALAYGAAVHFKIYPIIYALAFLVF
LNGNFSATNANWISSSNSLWAQFAGLLNRDRLAFGLVSGGLFIFLAAGCYYLYGFQFLYE
AYLYHFTRTDNRHNFSVYFYDLYLRYNTPSGFGVGLLAFLPQLTSLVAISFAYGRDLPFA
LFALTMVFVIFNKVCTAQVRNTILPFRT

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	127	318	2.5e-63	0.7099236641221374

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	4.17e-98	22	318	25	340	GPI mannosyltransferase
252941	Mannosyl_trans	2.26e-47	127	318	1	184	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA18245.1|GT50	3.21e-111	12	318	12	318
CBN81774.1|GT50	1.15e-88	8	318	14	323
AAH01803.1|GT50|2.4.1.-	5.05e-87	9	318	22	334
NP_660150.1|GT50|2.4.1.-	5.05e-87	9	318	22	334
BAB18567.1|GT50|2.4.1.-	5.05e-87	9	318	22	334

PDB Hits     

PPTG_01363-t26_2-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9H3S5|PIGM_HUMAN	8.96e-88	9	318	22	334	GPI mannosyltransferase 1 OS=Homo sapiens OX=9606 GN=PIGM PE=1 SV=1
sp|Q5RAH7|PIGM_PONAB	8.96e-88	9	318	22	334	GPI mannosyltransferase 1 OS=Pongo abelii OX=9601 GN=PIGM PE=2 SV=1
sp|Q4R4E1|PIGM_MACFA	8.96e-88	9	318	22	334	GPI mannosyltransferase 1 OS=Macaca fascicularis OX=9541 GN=PIGM PE=2 SV=1
sp|Q66IJ4|PIGM_XENTR	7.16e-86	8	318	17	332	GPI mannosyltransferase 1 OS=Xenopus tropicalis OX=8364 GN=pigm PE=2 SV=1
sp|Q54IA4|PIGM_DICDI	1.95e-85	5	318	25	353	GPI mannosyltransferase 1 OS=Dictyostelium discoideum OX=44689 GN=pigm PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000021	0.000000

TMHMM  Annotations     

Start	End
7	26
59	77
84	106
126	148
155	177
212	234
271	293
297	316