CAZyme Information: PPTG_01363-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_01363-t26_1-p1
• CAZy Family: AA17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
419		47871.28	9.1038

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669563:630580-632374(-)

Full Sequence      

MSRRTLALFGGALVARLVLLLYGYFQDHYMAVKYTDVDYDVYSDAAREMAEGKSPFERTT
YRYTPVLAFLLLPNIYVHEVFGKLLFVGCDILVGYILYQILRLRGLPDASAVNYCCVWLF
HPFSVNISTRGNADAIVVLLVMLSLLLVMRKQLVLSALAYGAAVHFKIYPIIYALAFLVF
LNGNFSATNANWISSSNSLWAQFAGLLNRDRLAFGLVSGGLFIFLAAGCYYLYGFQFLYE
AYLYHFTRTDNRHNFSVYFYDLYLRYNTPSGFGVGLLAFLPQLTSLVAISFAYGRDLPFA
LFALTMVFVIFNKVCTAQYFLWYTAFLPLIFPLTNLKLKWKGLAMILAWLGGELHWLYWA
YHLEMQGVNTFFPLWLAGLGFFSVNVLILATLMQHYSFTPLFRRGHVLQLVPNARAKDE

Enzyme Prediction     

No EC number prediction in PPTG_01363-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	127	392	4.4e-92	0.9923664122137404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	9.45e-137	22	418	25	440	GPI mannosyltransferase
252941	Mannosyl_trans	1.76e-72	127	393	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA18245.1|GT50	3.90e-154	12	407	12	407
VDD20265.1|GT50	3.93e-117	1	404	1	410
AAP59446.1|GT50	4.63e-116	1	404	1	421
ANM71067.1|GT50	4.63e-116	1	404	1	421
AED92986.1|GT50	7.45e-116	1	404	16	436

PDB Hits     

PPTG_01363-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q500W7|PIGM_ARATH	1.32e-116	1	404	16	436	GPI mannosyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=PIGM PE=2 SV=1
sp|Q9H3S5|PIGM_HUMAN	1.33e-112	9	404	22	419	GPI mannosyltransferase 1 OS=Homo sapiens OX=9606 GN=PIGM PE=1 SV=1
sp|Q5RAH7|PIGM_PONAB	1.33e-112	9	404	22	419	GPI mannosyltransferase 1 OS=Pongo abelii OX=9601 GN=PIGM PE=2 SV=1
sp|Q4R4E1|PIGM_MACFA	2.65e-112	9	404	22	419	GPI mannosyltransferase 1 OS=Macaca fascicularis OX=9541 GN=PIGM PE=2 SV=1
sp|Q5EA10|PIGM_BOVIN	7.75e-109	12	404	25	419	GPI mannosyltransferase 1 OS=Bos taurus OX=9913 GN=PIGM PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000021	0.000000

TMHMM  Annotations     

Start	End
342	359
371	393
7	26
75	97
135	149
159	181
212	234
271	293
300	322