CAZyme Information: PPTG_01267-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_01267-t26_1-p1
• CAZy Family: AA17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
301		33963.12	9.6849

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669563:231783-234276(-)

Full Sequence      

MWRCLPVRVFRRQRLSVCGFSTGSNLAPVRLYVVAGEASGDAIGAKVIRALQRHQPPRSL
EIRGIGGPLMSKAGAFESLFPMQELSVMGLLEVVPHIWRFQRRIHDTLRDIENYQPELIL
TIDSKGFTFRVLKALQASEQKSGGKRIKKVHYVAPSVWAYKHRGKRDFTELKQLLDAMFT
ILPFEEDIFNAGEEIQSPDNKGRTWCHFVGHPAVEDFLEINGVYESVALTGNRRHQSPGT
TSPGVTLLIFYETDTCRTGGKYFYISDVADAIGTHTLDTPQAIRSFMFGKMITMRVDRLS
S

Enzyme Prediction     

No EC number prediction in PPTG_01267-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	32	217	9.7e-48	0.4576271186440678

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
234580	lpxB	7.33e-54	28	212	1	162	lipid-A-disaccharide synthase; Reviewed
223834	LpxB	3.84e-52	28	216	1	168	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
397004	LpxB	1.07e-41	31	215	1	164	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
167141	lpxB	2.60e-27	32	215	230	392	lipid-A-disaccharide synthase; Reviewed
129319	lpxB	2.99e-25	33	212	10	166	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHJ68741.1|GT19	3.49e-40	27	215	3	167
AHJ66095.1|GT19	4.88e-40	31	215	6	167
APH57271.1|GT19	4.88e-40	27	215	3	167
APH52168.1|GT19	1.33e-39	27	215	3	167
AHJ63331.1|GT19	1.33e-39	27	215	3	167

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	1.84e-20	28	211	6	166	Lipid A Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	1.84e-20	28	211	6	166	Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0BS63|LPXB_GRABC	2.37e-40	27	215	3	167	Lipid-A-disaccharide synthase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) OX=391165 GN=lpxB PE=3 SV=1
sp|Q1RIC1|LPXB_RICBR	2.94e-37	30	215	3	167	Lipid-A-disaccharide synthase OS=Rickettsia bellii (strain RML369-C) OX=336407 GN=lpxB PE=3 SV=1
sp|A8GU85|LPXB_RICB8	2.94e-37	30	215	3	167	Lipid-A-disaccharide synthase OS=Rickettsia bellii (strain OSU 85-389) OX=391896 GN=lpxB PE=3 SV=1
sp|A8GN02|LPXB_RICAH	5.07e-36	30	215	3	167	Lipid-A-disaccharide synthase OS=Rickettsia akari (strain Hartford) OX=293614 GN=lpxB PE=3 SV=1
sp|Q5FUA3|LPXB_GLUOX	2.07e-35	31	238	31	210	Lipid-A-disaccharide synthase OS=Gluconobacter oxydans (strain 621H) OX=290633 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000029	0.000001

TMHMM  Annotations     

There is no transmembrane helices in PPTG_01267-t26_1-p1.