CAZyme Information: PPTG_01153-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_01153-t26_1-p1
• CAZy Family: AA17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
317		33596.38	4.2962

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669561:4472653-4473606(-)

Full Sequence      

MKAPPCILAFASLTACVQAHGYISKPKATYQPNTPYTDYNAITTAAVNKGFAGGKYNGSP
SQNTQVFTEHWNATGYKSLRDMTDPIATDYGHSVETATPVDVTGYTEMWWQNNEYKEGFI
ASHEGPCEAWIGETQVFHYDNCAARFKSYPAKIPADYSSCKGDCLFAFYWLALHEPNWQI
YKQCVPITNNGSGASTTTQSSSVGDNGGSTTTQASASTDDGPSDDIQTVTSTDNSASDVT
QSEASVGGEASNAEQTESTEAPSSTSNTPAPDTATPEPQPATDAPETTPSVPEAAPATPT
ATEAATPSGKCVLRRRS

Enzyme Prediction     

No EC number prediction in PPTG_01153-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA17	9	276	1.3e-64	0.926530612244898

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
183558	PRK12495	2.62e-04	211	290	63	145	hypothetical protein; Provisional
183558	PRK12495	0.001	188	291	76	172	hypothetical protein; Provisional
411196	act_recrut_TARP	0.002	200	289	380	470	type III secretion system actin-recruiting effector Tarp. The founding member of the Tarp (translocated actin-recruiting phosphoprotein) is CT456 from Chlamydia trachomatis. Tarp is a type III secretion system effector. Orthologs are found other Chlamydia, but are highly variable in length because many lack much of the repeat region.
236652	PRK10118	0.002	185	285	162	262	flagellar hook length control protein FliK.
411773	SP4_N	0.003	186	280	248	353	N-terminal domain of transcription factor Specificity Protein (SP) 4. Specificity Proteins (SPs) are transcription factors that are involved in many cellular processes, including cell differentiation, cell growth, apoptosis, immune responses, response to DNA damage, and chromatin remodeling. Human SP4 is a risk gene of multiple psychiatric disorders including schizophrenia, bipolar disorder, and major depression. SP4 belongs to a family of proteins, called the SP/Kruppel or Krueppel-like Factor (KLF) family, characterized by a C-terminal DNA-binding domain of 81 amino acids consisting of three Kruppel-like C2H2 zinc fingers. These factors bind to a loose consensus motif, namely NNRCRCCYY (where N is any nucleotide; R is A/G, and Y is C/T), such as the recurring motifs in GC and GT boxes (5'-GGGGCGGGG-3' and 5-GGTGTGGGG-3') that are present in promoters and more distal regulatory elements of mammalian genes. SP factors preferentially bind GC boxes, while KLFs bind CACCC boxes. Another characteristic hallmark of SP factors is the presence of the Buttonhead (BTD) box CXCPXC, just N-terminal to the zinc fingers. The function of the BTD box is unknown, but it is thought to play an important physiological role. Another feature of most SP factors is the presence of a conserved amino acid stretch, the so-called SP box, located close to the N-terminus. SP factors may be separated into three groups based on their domain architecture and the similarity of their N-terminal transactivation domains: SP1-4, SP5, and SP6-9. The transactivation domains between the three groups are not homologous to one another. SP1-4 have similar N-terminal transactivation domains characterized by glutamine-rich regions, which, in most cases, have adjacent serine/threonine-rich regions. This model represents the N-terminal domain of SP4.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ETN25011.1|AA17	1.23e-164	1	317	1	317
ETI56038.1|AA17	3.90e-161	1	317	1	317
ETP25842.1|AA17	4.53e-159	1	317	1	303
ETP53849.1|AA17	9.14e-159	1	317	1	303
ETP53850.1|AA17	4.47e-146	1	317	1	317

PDB Hits     

PPTG_01153-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

PPTG_01153-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000591	0.999395	CS pos: 15-16. Pr: 0.6922

TMHMM  Annotations     

There is no transmembrane helices in PPTG_01153-t26_1-p1.