CAZyme Information: PPTG_01140-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_01140-t26_1-p1
• CAZy Family: AA17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
505		56213.99	7.5430

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669561:4430912-4432429(+)

Full Sequence      

MIWPTNYGKLACATMFTLFWAGKKYAPSCYVDGVQIQEYLQSHYLDSLVALAEALKGLTN
VVGFGTMNEPSSGFIGVNDLNKPVGIIQNGYAPTAFQGMTLGEGIAQDVDVWNAGLMTMI
RGKPSKVEKVDPQGVRAWKEGFGCVWKEAGVWGFDAENKPQLLKPDYFSDVDFGKDFYVP
FAKKFTKRLQNVFPNALIFVEMPPVDFGDMEFPQITNEDVPNAVNAMHWYDGITLLTTTW
RSYFTVDFATGKPVFGNKALRKVHRQQLAHVASFGRKKMNNAPTLIGETGIPYNMNEARA
YISGDYSAQIEAMDNTISNLESQLLSYTLWNYTADNSHEFGDLWNLEDLSISSPDSEALA
IRLAGGHTRRRDDPARGLKGFARPYARKITGVPLKSTFTMATAEYVLEYVSVNTETSAPT
EIYVPYVHYPGGYRVTSSDGHCTIKKHENYDIVTYAHDVKAHKHRVIVSPRTPVGGDPKR
ANAPLYIALAVTAVAVPLLTLYKRR

Enzyme Prediction     

No EC number prediction in PPTG_01140-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	1	338	2e-105	0.6920222634508348

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408348	Glyco_hydro_5_C	1.54e-22	383	468	1	86	Glycoside hydrolase family 5 C-terminal domain. This is the C-terminal domain of endo-glycoceramidase II (EGC), a membrane-associated family 5 glycosidase pfam00150. The C-terminal domain assumes a beta-sandwich fold, which resembles that of many carbohydrate-binding modules.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ27469.1|GH5_12	1.19e-172	1	502	187	706
AIG56220.1|GH5_12	9.90e-146	1	496	199	684
CCA13966.1|GH5_12	2.77e-145	1	473	228	735
BAJ64239.1|GH5_12	2.65e-111	1	435	168	591
QPC82820.1|GH5_12	8.06e-104	1	473	170	632

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LPO_A	2.33e-66	1	438	197	725	Chain A, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPO_B Chain B, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPO_C Chain C, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPO_D Chain D, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_A Chain A, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_B Chain B, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_C Chain C, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_D Chain D, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_A Chain A, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_B Chain B, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_C Chain C, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_D Chain D, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I1BTD7|EGCR1_RHIO9	3.52e-73	1	473	186	662	Glucosylceramidase OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) OX=246409 GN=ERC1 PE=1 SV=1
sp|P40566|EGH1_YEAST	1.06e-66	1	458	190	730	Ergosteryl-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EGH1 PE=1 SV=1
sp|H1AE13|EGCR1_ASPFM	2.60e-65	1	355	174	565	Glucosylceramidase OS=Neosartorya fumigata OX=746128 GN=egc1 PE=1 SV=1
sp|H1AE12|EGCR1_CRYNH	6.17e-49	2	425	183	635	Glucosylceramidase OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=EGC1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000022

TMHMM  Annotations     

Start	End
483	502