CAZyme Information: PPTG_01027-t26_3-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_01027-t26_3-p1
• CAZy Family: AA17
• CAZyme Description: trehalose-phosphatase, variant 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
804		91840.46	7.3579

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669561:3776022-3778637(-)

Full Sequence      

MGSPDGWTPETPVIIAANRLPVRLSRTSDGQWRVEWAGDRMIESQNTLSHYEISERATIK
FVGRVVDVDVPFEERQQVEILLREINCFPVFLEPQEAKLYYEDYCKQTLWPTFHNVVDVY
SPVDVVLDVQAQQHLAPSAQFWNPNWQKVAWQAYANVNQLFAHKICELYEQGDVVWVQDY
HLLLTPSYIVRKLRAANVGLFLHVPFPSSEVFRTLSMRKELLRGMLNADHIGFHLFEYAR
HFMSACRRILGLSYEPILRGQLGIDYGGRRVAVTCSHMAIDVQRIEETLVSADVRDMVVN
LRQKYRDKKIFAGCDTIERLKGIPSKMLAFDGFLSRCPDFIGKAVLVQKGIHRRGRVTDY
VQSKKEIEQAVQTINNKYRDVAKGNVVDYEEVDEFPYKKRVALWRVADVQITTVLRDGLN
TTPFEYIATHKTSPGVLILSEFSGSSRLLSGALTVNPWELDQVIDALRDAVYMPTNEREH
RRNCDFQFVAANPPRRWAKCVLTDIVNARKKEEAFVYMGTGFGLDFRLMEVSAQFRKLTG
EELAPAYRTSTSRAIFLDYYRTLAPDVSKLMGVRWPDVPLSALSTLEQLCKDPRNTVFIV
SGCNCDLLTQKFGGVPGLGLVAEHGYFIRRAVLGNNARIGRPWERHGDILQSDGGHQQWR
VKAEKIIQLYVDRTNGSTLELRRSAVLFRYGKSDFDFGALQAAELKEHLEGVFEGWPLNI
IQGKDYIEVRPEGVGKGKLIGHLLNKMRVDGNPANFVLCIGDDVADELMFEQLKTMVAHE
ELPKGEYYLVMNSSQIFVMITFML

Enzyme Prediction     

No EC number prediction in PPTG_01027-t26_3-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	12	505	7.8e-145	0.9663157894736842

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
177855	PLN02205	4.94e-173	8	788	57	816	alpha,alpha-trehalose-phosphate synthase [UDP-forming]
184712	PRK14501	2.38e-168	13	773	3	690	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
340820	GT20_TPS	1.57e-147	12	505	1	462	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	1.43e-136	13	505	3	468	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
215556	PLN03064	2.21e-127	14	761	97	797	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ27356.1|GT20	0.0	5	788	16	801
CCA16404.1|GT20	1.63e-310	10	788	3	798
CCA19238.1|GT20	1.63e-181	13	796	265	1069
UIZ24099.1|GT20	2.75e-179	13	776	292	1083
AAV65495.1|GT20	4.64e-159	14	783	62	805

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HVO_A	8.06e-90	1	506	1	475	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HVM_A	1.83e-85	10	478	11	447	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
6JBI_A	1.80e-84	13	479	2	436	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HUV_A	7.06e-84	13	505	6	467	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]
5HUT_A	9.85e-84	13	505	6	467	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9LRA7|TPS9_ARATH	3.91e-155	14	783	62	805	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 OS=Arabidopsis thaliana OX=3702 GN=TPS9 PE=2 SV=1
sp|O80738|TPS10_ARATH	6.57e-155	14	778	62	800	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 10 OS=Arabidopsis thaliana OX=3702 GN=TPS10 PE=2 SV=1
sp|Q0WUI9|TPS8_ARATH	8.89e-150	14	782	60	799	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 8 OS=Arabidopsis thaliana OX=3702 GN=TPS8 PE=2 SV=1
sp|O23617|TPS5_ARATH	1.05e-149	13	771	62	793	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 5 OS=Arabidopsis thaliana OX=3702 GN=TPS5 PE=1 SV=2
sp|Q94AH8|TPS6_ARATH	8.35e-148	8	788	50	822	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 OS=Arabidopsis thaliana OX=3702 GN=TPS6 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000070	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PPTG_01027-t26_3-p1.