CAZyme Information: PPTG_00925-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_00925-t26_1-p1
• CAZy Family: AA17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
852	KI669561|CGC5	92555.49	4.2730

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669561:3407613-3410171(-)

Full Sequence      

MRGLAVIIPALLASTNLVAASSDYSVFTPKKLALGTEPTMSSKAYINRFTLTTENPVATL
DYDYEVAGLPYFVVSSVYNGPVDIEVKYSEQFSVLSTNFSDGPSQYATAVANSRRVETHR
VETHRFTENEIGVTVTSMLSQPGQRWQTLHLLSGNSITFEAVGLQASIEVIDDLSMLPGK
FSCSNTKYNEIWQLGARAVSAACLDAGSQIPSWNVSEENGALVPGTRPGVSYKAWNLSDY
TLEFETQIIRGGVGFYIGYDITANRGSLMFHLSSEYPADSTYVNTNSTLFPANTLTLTYG
FDFVNATDMISYVLGTSDLPFNVKEHVWYPVKIAVNSTAGNLVVWLDNQPVMDITISDLG
FNESQLSLLGYSTTGKGAIGFGGWQDQASFVRNVKATSLNDSSKTLYSNPMTDESVVLPE
FGVQSNTYAACLDGAKRDRYIWLGDFYHTTRIMGVANSKPEQITGTWEYLFDYQASNGQF
PGLMVMTYETPMPTPEVFTFNAGTSDAYLNFPDYDILGLIGFVSYMEYYDDVEFAKANWV
SFRKATDWLVSRQGSDGLIDVTKYVAVFLGSGTGTAVNAAAVQCLEGMAKVATAVGDEDS
ANQWVEVASSIKTAINGLLWNEAFGNYAVDASTPEVYGVSAIAFAITSGVANETQADLCV
KTLEKLRRGPGYLDTSATDNSTKISPNTNGFLLDAMLQTGHTGEAAFLLDNLWDAMISNE
NYRSGASWEYVSQSLEPGIKEFTSLNHPWGGAPTYVLTNYVAGIRPVEFGFRRWIVNPLV
TGLNITSANATVSSPYGALTAAWEKTASNVLSVTITAPTGTEGVFEVVQLNSSSFQQTLN
GTGEPISFSVQL

Enzyme Prediction     

No EC number prediction in PPTG_00925-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	408	824	5e-64	0.7658730158730159

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	1.19e-13	472	761	74	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
379972	Bac_rhamnosid_C	6.83e-09	763	828	1	62	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCD52401.1|GH78	7.18e-197	25	840	23	830
ATZ56607.1|GH78	3.00e-196	21	840	43	854
QMW40986.1|GH78	1.83e-177	27	825	26	806
QMW28911.1|GH78	1.83e-177	27	825	26	806
QRD85156.1|GH78	1.83e-177	27	825	26	806

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	3.06e-08	432	797	331	670	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

PPTG_00925-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000299	0.999679	CS pos: 20-21. Pr: 0.9670

TMHMM  Annotations     

There is no transmembrane helices in PPTG_00925-t26_1-p1.