CAZyme Information: PPTG_00922-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_00922-t26_1-p1
• CAZy Family: AA17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
697		75670.64	4.0850

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669561:3399260-3401936(+)

Full Sequence      

MRSIGLALLLAPALAELCFADNLDKYGIFTPKKIALSSVPSMDGQSYSGGFTLSTDEPLA
TLDYNYEVAGLPYFVVSSVSNGPVEVEVKYAEQFPALSLNYSDGPSQFTTSIANSRRVET
HRFTEDEIGTTITSILSQPGQRWQSLRLLTGDSITFETVGLQASVEVIDDLTTLPGKFSS
SNAKYDEIWKLGARAVTAACLDAGSQVPSWSSSEENGTFVPGTRPGISYRTWNLTDYVLT
FDSQIIRGGAGYTIAYDLTGNRDGVQIHLASEYPNDTTFSNINTTLFPANTVTLAYGYDF
ANATSMTSYILGQYDVPFNVKENVWYPVEIRVNATAGNIVFSIDGQQVFDIILTEMGFTD
SQLSFYGYASRGEGAIGFGGWQDQASYVRNVTATSLSDSSKVLYSNPMTDESVVVPEFGG
QSNAYGVCMDGAKRDRYVWLGDFYHTTRIMGVANSKPEQIAGTWEFLFEYQAATGQMAGF
VPISYQSPMPTPEVFLNDAGTVDAYYNFPDYVILGMIGLVSYMDYYDDDAFVKAHWEEFT
RAMTWLIGNQGSNGLIDLTKYVVVFLGPGAGMAVNAAAVQCLDGMAGVARAVGDLESANS
WLQVAASVKAAINELLWNDALGNYAVDVSTPEVYGVSATAFALTSGVANETQTKLIVDGL
EGLRQGPGYLDSTLSMDIREQFVLFSNIACAIGHKYM

Enzyme Prediction     

No EC number prediction in PPTG_00922-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	396	661	1.6e-28	0.4861111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	1.52e-05	422	648	26	256	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
395961	Trehalase	0.002	593	675	326	416	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
225942	GDB1	0.004	503	671	332	528	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCD52401.1|GH78	1.48e-138	18	673	19	653
ATZ56607.1|GH78	1.09e-137	31	673	51	677
QMW40986.1|GH78	5.86e-137	11	673	13	644
QMW28911.1|GH78	5.86e-137	11	673	13	644
QRD85156.1|GH78	5.86e-137	11	673	13	644

PDB Hits     

PPTG_00922-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

PPTG_00922-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000237	0.999749	CS pos: 20-21. Pr: 0.9768

TMHMM  Annotations     

There is no transmembrane helices in PPTG_00922-t26_1-p1.