CAZyme Information: PPTG_00797-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_00797-t26_1-p1
• CAZy Family: AA17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
263		29028.81	6.1249

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669561:3032366-3033157(-)

Full Sequence      

MVQFSAIFGMVALASAFVADPVVAVDKPLPWDGRGYDLTVETVSEKYLTHILTMRNNGTD
GKVSDYVSIEKGGRLPAYNGDTGIINIGVDSKAIFKTQTNFRRSELVQNVAANTKGTTFF
RTSVMKEDDFLNPYAWQMIFPESHIFEIRVDATSSPAKIIYLNNGTYDAKWETEFVPGTW
YNFGIGISPAASGKGSVLEFYTSEGNKKLVRKAKHEYATELPTNYEFHIGLLTLTDDGSA
PKMNAKQDIVSYNGVSVDAKVSK

Enzyme Prediction     

No EC number prediction in PPTG_00797-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH131	60	257	4.5e-24	0.8156862745098039

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408085	GH131_N	6.32e-67	29	262	1	250	Glycoside hydrolase 131 catalytic N-terminal domain. This is the N-terminal domain found in glycoside hydrolase family 131 (GH131A) protein observed in Coprinopsis cinerea. GH131A exhibits bifunctional exo-beta-1,3-/-1,6- and endo-beta-1,4 activity toward beta-glucan. This domain is catalytic in nature though the catalytic mechanism of C. cinerea GH131A is different from that of typical glycosidases that use a pair of carboxylic acid residues as the catalytic residues. In the case of GH131A, Glu98 and His218 may form a catalytic dyad and Glu98 may activate His218 during catalysis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26396.1|GH131	7.04e-103	1	261	1	262
CCD28226.1|GH131	1.72e-99	11	262	4	253
UIZ26845.1|GH131	9.00e-95	7	261	343	598
CCA28146.1|GH0	6.89e-27	23	263	16	253
CCA67649.1|CBM1|GH131	2.06e-14	13	236	5	222

PDB Hits     

PPTG_00797-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

PPTG_00797-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000228	0.999748	CS pos: 24-25. Pr: 0.6654

TMHMM  Annotations     

There is no transmembrane helices in PPTG_00797-t26_1-p1.