CAZyme Information: PPTG_00683-t26_3-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_00683-t26_3-p1
• CAZy Family: AA17
• CAZyme Description: trehalose-phosphatase, variant 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
660		74668.92	7.1818

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669561:2674800-2676912(+)

Full Sequence      

MLAAEMEPELGESSLLDQLHDLHRRLAAVRQDSQRYTSLARNLGPIPMANDSNKIIVCSL
RRCVRMLKTERGDSWQYIPSATGLKSAIDYLGKGNTVRWVSWPGANVDESSQDGVRRRLE
TDFACHPVFLSHETVDLYQNQFCNVVLWPLFHSLPQRSDSRLLENFGEKYDAYCSANQKF
LEAVSEIYKDGDLVLVCDYQLMALPGLLRRRFPEITCGFYFHCPFPSSEFFQMLPVREAL
LHGVLGADLVVFNHFDYVRHFLNVCTRMLGLESSPSRVEYNGRLISLGICPMGIDPAKYA
LTPKVEANVEMLKRQQDGMKIIVGVHKLDFCKGIPEMLEAMEYLLQHYPEYRGKVVLYAV
VRDAGRTSSLQYRMLSRQINELVGRVNGKFGTAEYCPVRYLKQSIDHDQLVALYNCADVA
IVSSIKEGINLQAMEFIAAQKKSCHGVLVYSEFAGCASSFQGALLVNPMHIEQVAASVDT
ALRMNNTTKRIRHHQLSRYVNTYTSTLWAQRIMSALNEAAATAQEYNRLDKLDTAQLLGY
YERSQRRLFLLDYDGTLVNYQSMEELAEPSAALMSCLEDLTADPHNTVYIISGRNKNRLQ
VLLPLALMLYSFVAHLTSCLLNRNGLVTYRESDWLQSMAIGSVLPPNTRLSPILIVVGIS

Enzyme Prediction     

No EC number prediction in PPTG_00683-t26_3-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	51	517	8.6e-152	0.9747368421052631

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
184712	PRK14501	7.02e-179	69	599	15	545	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
340820	GT20_TPS	7.11e-176	54	517	1	463	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	1.33e-164	52	518	1	470	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
215556	PLN03064	4.72e-144	69	599	108	653	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
223457	OtsA	2.95e-137	50	521	12	482	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29132.1|GT20	0.0	9	600	14	604
CCA19773.1|GT20	0.0	11	600	25	615
CCA26754.1|GT20	0.0	11	600	25	615
QOX06485.1|GT20	4.65e-142	7	600	14	629
BAM81439.1|GT20	1.69e-141	33	600	318	899

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HVM_A	3.05e-125	54	521	13	479	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
6JBI_A	2.39e-119	54	517	1	463	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HVO_A	2.07e-118	53	521	11	479	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HUT_A	1.76e-109	54	516	5	467	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]
5HUV_A	6.92e-109	54	516	5	467	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54K57|TPSA_DICDI	5.12e-142	52	600	15	556	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1
sp|P40387|TPS1_SCHPO	2.37e-126	49	516	15	481	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tps1 PE=1 SV=2
sp|Q4WLM9|TPS1A_ASPFU	1.57e-124	54	521	13	479	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=tpsA PE=1 SV=1
sp|Q00075|TPS1A_ASPNG	4.69e-124	47	525	7	484	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 OS=Aspergillus niger OX=5061 GN=tpsA PE=1 SV=1
sp|O59921|TPS1_EMENI	2.16e-121	49	523	8	481	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=tpsA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000043	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PPTG_00683-t26_3-p1.