CAZyme Information: PPTG_00551-t26_2-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_00551-t26_2-p1
• CAZy Family: AA17
• CAZyme Description: hypothetical protein, variant

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
691		78340.04	6.2424

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669561:2114474-2116639(-)

Full Sequence      

MQKGSTKGLNALVKARNWMADWEDRDGSLTQVKEMLEEGLKLGQLPDLNAYDVVELPPKT
MVELRRRVYEELETSTERLCCDERINLRLQAPELRIGFVSSDFGVHPVSSLLRGLLALLS
SSDHQTKVYCFSLLDASSWWSRNISRTVDFMISLKGKNSLDAAKIIQSHEIHVLVDLNGH
TLHSGISIFTHRPAPLQVAYLGYPMTTGYPSIDFVVSDGVATPAETSGGSFSEKLLLLPM
HYIVNDHLQMLGHTLEGKRPRLSPYFDLDDNTFVFATFSNWQKMDPSVFSAWMEILARVP
SSVMWFQEYFGHEGAITNLRNEAEAHGINDNRLIFSSLDSWIDHTYRKRIADLILDTPLK
NGHTTILDALCAGVPVITLEGDQMHNRASSSALNALDLHDLTVNSFKEYVEVAVYLATHK
HVLQKLRKNVEDNRLHYPLFDTAKYATKFEEAIKVAWQVKKSRLLTGKPTREMHIFPSIQ
SSTVMPRSFPVLSAKEDSNAEDEYIVRVQNALDTQQPIRLHIGGHIKSPDWWIVDANDGD
IVDFVMYISNLYAFRDNSVDTIYSSHVLEHCTHGFGHELEHTLREWHRVLRPGGQLLVSV
PNLFALATLFTNESIPHQHRVWIMNVIYGGQIDQYDLHKVGFDETILVAYLSQAGFCDFT
RHDDFGLFNDSSTLVVYDTPISLNIQARACK

Enzyme Prediction     

No EC number prediction in PPTG_00551-t26_2-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT41	87	471	7.1e-91	0.48226950354609927

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226428	Spy	8.40e-74	82	452	248	610	Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones].
404688	Glyco_transf_41	3.13e-62	81	446	56	540	Glycosyl transferase family 41. This family of glycosyltransferases includes O-linked beta-N-acetylglucosamine (O-GlcNAc) transferase, an enzyme which catalyzes the addition of O-GlcNAc to serine and threonine residues. In addition to its function as an O-GlcNAc transferase, human OGT also appears to proteolytically cleave the epigenetic cell-cycle regulator HCF-1.
226975	COG4627	6.92e-29	518	687	7	183	Predicted SAM-depedendent methyltransferase [General function prediction only].
400514	Methyltransf_11	1.18e-10	554	598	55	94	Methyltransferase domain. Members of this family are SAM dependent methyltransferases.
404528	Methyltransf_25	7.06e-09	554	594	60	97	Methyltransferase domain. This family appears to be a methyltransferase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALF56465.1|GT41	2.69e-76	94	475	24	392
AFZ26553.1|GT41	2.96e-74	1	459	614	1066
UIZ23060.1|GT41	3.78e-74	18	458	483	924
QSV69586.1|GT41	8.87e-73	49	688	548	1287
CAA7405023.1|GT41	1.63e-72	12	459	530	983

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5A01_A	5.99e-54	19	458	156	696	O-GlcNAc transferase from Drososphila melanogaster [Drosophila melanogaster],5A01_B O-GlcNAc transferase from Drososphila melanogaster [Drosophila melanogaster],5A01_C O-GlcNAc transferase from Drososphila melanogaster [Drosophila melanogaster]
6Q4M_A	1.67e-50	19	458	158	707	Crystal structure of the O-GlcNAc transferase Asn648Tyr mutation [Homo sapiens]
6IBO_A	2.27e-50	19	458	158	707	Catalytic deficiency of O-GlcNAc transferase leads to X-linked intellectual disability [Homo sapiens]
5NPR_A	2.89e-50	19	458	152	701	The human O-GlcNAc transferase in complex with a thiol-linked bisubstrate inhibitor [Homo sapiens]
5NPS_A	2.93e-50	19	458	153	702	The human O-GlcNAc transferase in complex with a bisubstrate inhibitor [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9M8Y0|SEC_ARATH	2.05e-69	22	459	511	954	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana OX=3702 GN=SEC PE=1 SV=1
sp|Q8CGY8|OGT1_MOUSE	1.26e-49	19	458	476	1025	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus OX=10090 GN=Ogt PE=1 SV=2
sp|O18158|OGT1_CAEEL	1.99e-49	19	458	580	1130	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase OS=Caenorhabditis elegans OX=6239 GN=ogt-1 PE=1 SV=2
sp|P81436|OGT1_RABIT	7.41e-49	19	458	476	1025	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus OX=9986 GN=OGT PE=1 SV=2
sp|O15294|OGT1_HUMAN	9.94e-49	19	458	476	1025	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens OX=9606 GN=OGT PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000060	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PPTG_00551-t26_2-p1.