CAZyme Information: PPTG_00397-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_00397-t26_1-p1
• CAZy Family: AA16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
876		93909.96	4.1327

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669561:1557715-1560345(+)

Full Sequence      

MVSVTWGIALALYTQLVSAGDPLATVSWRTGNDKVDAIIEALTAEEKVSLVHGTVDSEGN
QQQAGYSVAIPSQGIPEFRLADGEAGINIVQNATGSPAQLNVAATWSLNAAYQHGVITGK
EAKLFNMAVALSPRVNILRDPVTGNFWQSYSEDPYLNARLGIQGVKGLQDQGSMANAKQI
GPSSTGASAGDTNSIVDFQTLQELYWVAPGTLLQEGNAATLMCSYAQINGIPACQYEPLF
NTVRDDYNSSAIVMSDWGATHSTAESLVAGMDLEMPTGSYYDALYDYIYVSKNLSESYLN
RAVGHILAKYDEFGLLGTTTEGSSPLPQDVVEDHAKISYDIAVKSGVLLKNDNNTLPIKS
GSSIAVIGPNGVQYTHGTNFAERAYGFPDRQVSTLEALKSRLGEDVANAVGVDQEGTIIP
STHLRNLQGNPGLSRNDSLGGSSNDEIVYFTGTSALPKNASYTWQGQVYAETDGYYTFSF
ARAIPSWENHTNPDYGSTWSIGTFSITGSEVGEGYRLFGDGGVKPWSNSIATRDNWDNIK
SYVYLEEGWHDMEAYIVGLLDEPTSVRLTWVTPAQRSANIQLAVDIAQEVDTPIVFAFAN
SPAQTGLTLDDGLDELVTKVAAANPNTVVVLNNAEPVLMPWLDDVAAVLEMLYPNQEGGW
ATADLLLGNNVPQGRLPVTYPASLDSTMTRNPDYPERVATESGNATFSEGLNAGYRWYVH
TNTSVLFPFGYGLSYTSFEYSNPNFAASSSTQQSSSGLNYEVSCSPDDADAVFSVSFTVT
NTGSVKGVEVPQVYIGPPADAATAYPDVQFAATALVGFANVELEAGASTTVTIGVREKQL
SFYNVNTTSWEAAKGERPLCISKNAEEAVFSGKVQL

Enzyme Prediction     

No EC number prediction in PPTG_00397-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	69	276	1.3e-41	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	7.16e-43	97	844	121	734	beta-glucosidase BglX.
224389	BglX	2.20e-39	41	370	16	363	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	5.37e-32	37	844	55	752	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	7.64e-28	567	735	68	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	4.17e-21	53	307	47	314	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBM70396.1|GH3	3.68e-143	29	867	19	829
BBM73383.1|GH3	3.68e-143	29	867	19	829
AYA42665.1|GH3	7.26e-143	29	867	19	829
ACY48950.1|GH3	1.02e-142	29	867	19	829
QEU90354.1|GH3	2.71e-138	17	872	23	849

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4I3G_A	1.52e-100	38	876	57	828	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]
3AC0_A	1.13e-60	35	867	6	827	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	6.74e-58	35	867	6	827	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.26e-56	35	876	5	668	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
6JXG_A	9.49e-56	28	875	6	711	Crystasl Structure of Beta-glucosidase D2-BGL from Chaetomella Raphigera [Chaetomella raphigera]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	3.31e-70	34	876	10	836	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|A1CA51|BGLI_ASPCL	2.71e-69	35	871	6	825	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	1.74e-65	35	871	6	826	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	2.37e-65	35	871	6	826	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|Q5BB53|BGLI_EMENI	3.24e-65	35	855	6	810	Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglI PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000296	0.999663	CS pos: 19-20. Pr: 0.9787

TMHMM  Annotations     

There is no transmembrane helices in PPTG_00397-t26_1-p1.