CAZyme Information: PPTG_00140-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_00140-t26_1-p1
• CAZy Family: AA1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
460	KI669561|CGC11	48819.82	4.2356

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669561:562594-563976(-)

Full Sequence      

MHSILHSRTVATAVSCMALALSSSIGLTSAEELCSIPPYSYTRAKSDHPELTSAIETLEN
YAIASWFTDRQGTDERSTMLSNMLNQCSEETRLSIVVYGIPNKDCAAGLSSEGSVKSTDD
YKAFLQELTGAIGDRKVLYVVEPDALGLLAEEGGCGASAGYLDNLKVAVEALSSNPNAEL
YIDIGYWMLAYPDSASKVATAMKEIVTSGRVKGVTINTSNYRSTDECTTYCTNFQTAMGK
SDMSCVVDTSRNYNGSPTSDWCNVQTAGIGKPPTSETGVSNIDYFMWIKPPGESDGECPT
GGTSAGSFYLEGFTLLWDQSYFVSEQGMPKIGDGPSTPAPTKYEPNSSADDENQSAPDQT
TSMPTHAPTTDNSNWNQEQTVGTVAPADTTSTEAPSTPETVAPSTTAPVMETTTAPSYST
TPATTAPSTTASTGQTESTTQSNTIPPRSACKAKKRLRSL

Enzyme Prediction     

No EC number prediction in PPTG_00140-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH6	43	299	2e-62	0.9455782312925171

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396075	Glyco_hydro_6	6.75e-52	49	304	2	293	Glycosyl hydrolases family 6.
227616	CelA1	1.26e-16	13	309	115	399	Cellulase/cellobiase CelA1 [Carbohydrate transport and metabolism].
237019	PRK11907	5.57e-04	352	436	29	113	bifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase.
183558	PRK12495	0.005	332	442	79	187	hypothetical protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ23635.1|GH6	1.45e-183	5	388	2	375
UIZ23641.1|GH6	1.58e-89	27	327	22	328
AIG55974.1|GH6	1.17e-82	30	331	22	324
CCA16954.1|GH6	1.14e-81	31	339	21	336
AIG55947.1|GH6	1.05e-79	32	326	18	304

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1UP3_A	1.62e-29	44	308	25	280	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with METHYL-CELLOBIOSYL-4-DEOXY-4-THIO-BETA-D-CELLOBIOSIDE at 1.6 angstrom [Mycobacterium tuberculosis H37Rv]
1UP0_A	1.62e-29	44	308	25	280	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with cellobiose at 1.75 angstrom [Mycobacterium tuberculosis H37Rv]
1UOZ_A	2.47e-29	44	308	46	301	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with thiocellopentaose at 1.1 angstrom [Mycobacterium tuberculosis H37Rv]
1UP2_A	4.23e-29	44	308	25	280	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with glucose-isofagomine at 1.9 angstrom [Mycobacterium tuberculosis H37Rv]
1TML_A	3.36e-28	95	308	70	274	CRYSTAL STRUCTURE OF THE CATALYTIC DOMAIN OF A THERMOPHILIC ENDOCELLULASE [Thermobifida fusca],2BOD_X Catalytic domain of endo-1,4-glucanase Cel6A from Thermobifida fusca in complex with methyl cellobiosyl-4-thio-beta-cellobioside [Thermobifida fusca]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P26414|GUNA_THEBI	4.98e-27	95	302	104	307	Endoglucanase A OS=Thermobispora bispora OX=2006 GN=celA PE=3 SV=1
sp|P26222|GUN2_THEFU	1.98e-26	95	308	101	305	Endoglucanase E-2 OS=Thermobifida fusca OX=2021 GN=celB PE=1 SV=2
sp|Q7SIG5|GUN6_HUMIN	1.37e-23	89	320	77	341	Endoglucanase-6B OS=Humicola insolens OX=34413 GN=cel6B PE=1 SV=1
sp|P13933|GUN1_STRSS	5.49e-23	56	309	105	354	Endoglucanase 1 OS=Streptomyces sp. (strain KSM-9) OX=74575 GN=casA PE=1 SV=3
sp|P07984|GUNA_CELFI	5.87e-23	95	311	238	438	Endoglucanase A OS=Cellulomonas fimi OX=1708 GN=cenA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.005396	0.994560	CS pos: 30-31. Pr: 0.9370

TMHMM  Annotations     

There is no transmembrane helices in PPTG_00140-t26_1-p1.