CAZyme Information: POW22999.1

Basic Information

• Species: Puccinia striiformis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia striiformis
• CAZyme ID: POW22999.1
• CAZy Family: GT58
• CAZyme Description: Chitin synthase [Source:UniProtKB/TrEMBL;Acc:A0A2S4WML6]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
989		109746.43	7.3851

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pstriiformis93TX-2	14629	N/A	0	14629

• Gene Location: location=PKSM01000004:35575-40742(-)

Full Sequence      

MSSNRTDPFADQPHPELGRYTLSDNEDPLSPQAPVDTHYYGNLNPSPSDSHSGESDGYEL
GTPSGRYEAPAPFGGHEDDEGFPLKEAPFDSNMGGFRAEAGGLAPASKSESSSTNNFGFP
APNVSDGHTEASRYSTASSATAKLYRTQTTTEAWGRRQRIDPKRAKTIKVKLQHGHFVNE
YPVPTAVKNGNMAGGYKGETTEFSHMRYSAVTCDPDDFTREAGWTLRTENYGRSTELLVA
ITYYNEDKILVARTLHGVMLNLRDMCKAKWSEFRHLAKKGGEEAATEPWKMISVVLVFDG
IEPADKASLDVLATVGLYQDGIMKRQVDGKETQAHVFEYTTLLSVSPKPELIQPTPNDPA
NLVPVQMTLVLKQKNAKKINSHRWLFNAVAAHLQPEVCILIDAGTKPGNRSLYYLWEAFH
HNKHLGGACGEIHAMLARGKKLLNPLVAAQNFEYKMSNILDKPLESSFGYVSVLPGAFSA
YRYQAILGRPLQQYFHGDHSLSERLGKKGIQGMGIFKKNMFLAEDRILCFELVAKAKSRW
VLGYVKPAKGETDVPEEAAELLIAVSSVVALFDPLIANKGSFAAGIYALAHFSRMYSSGH
GFIRMFFLHVQAFYTTAGLVMSWFALGNWFTTFAAIIDIIAENWRDPFLAAGITDYNSAP
PPSPATTPEQLQAAVAWKIKECWSGTSFDDSAHLKDNSVPSKHDFLGYAHWILKIVYLCL
VALQVILALGNRPKGEKAAYFISFIVFGTFAAYLLGMTMILTINAFCPLSAQLEASEGVG
VIQIFMGSTYGPIFAGIMGTFGIYIVSSILYMDPWHILHSMIPFLLVAVSFTNILNVYAF
CNLHDVSWGTKGSDKAEALPSISSKKISKEGDVQIVEDIHRNQTDLDAQFQQTVLRAVQP
FTTSEEIEKPTEDDSNKTFRTRFICIWLIMNVILTIAMLRLNSANRTKYFQAILWSTFGF
AVVKFCGFVYYMFGASFFRLARLCARARR

Enzyme Prediction     

EC	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	243	419	9.8e-64	0.9938650306748467

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396286	Chitin_synth_1	1.14e-85	243	419	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
133033	Chitin_synth_C	7.82e-78	239	562	1	231	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
400626	Chitin_synth_1N	1.69e-33	169	242	1	70	Chitin synthase N-terminal. This is the N-terminal domain of Chitin synthase (pfam01644).
224136	BcsA	1.42e-17	369	642	116	364	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	5.94e-14	360	487	48	167	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABB70409.1|GT2	0.0	1	989	1	977
CDR40400.1|GT2	0.0	122	989	134	959
CDI55582.1|GT2	2.61e-304	36	971	42	894
SAM85457.1|GT2	7.22e-301	113	971	100	902
QYK92506.1|GT2	7.29e-301	153	982	116	893

PDB Hits     

POW22999.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P30598|CHS1_USTMA	1.29e-302	153	971	142	906	Chitin synthase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS1 PE=3 SV=3
sp|J9VMX7|CHS7_CRYNH	1.03e-280	156	971	125	918	Chitin synthase 7 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS7 PE=2 SV=2
sp|Q92197|CHSC_ASPFU	3.64e-271	152	972	106	881	Chitin synthase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chsC PE=3 SV=2
sp|Q00757|CHSB_EMENI	5.71e-268	124	989	95	916	Chitin synthase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chsB PE=2 SV=2
sp|P54267|CHSG_ASPFU	2.25e-263	151	989	121	911	Chitin synthase G OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chsG PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000063	0.000000

TMHMM  Annotations     

Start	End
605	627
705	727
742	764
784	806
821	843
923	942
952	974