CAZyme Information: POW22707.1

Basic Information

• Species: Puccinia striiformis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia striiformis
• CAZyme ID: POW22707.1
• CAZy Family: GT43
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
571	PKSM01000007|CGC2	64952.07	9.0252

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pstriiformis93TX-2	14629	N/A	0	14629

• Gene Location: location=PKSM01000007:460796-462796(-)

Full Sequence      

MSTTNLIGGPVQTSRRPRDTSTRSGWNFFRRPALLPKLLKPIWTAYLISAILYTTSVVLI
FPVFRLLFSGLSNSQQSRVDHIIPAIQSSTIQIVPRLLPNHHVDSHSLDNLKIRKNLKGT
SVNTDEVIAEDDASLWTSKTTKVTLRVTSPTSFRRTVDGRPIPPRSTLKGFDPSLSDMVD
WYPAAHNLSQGAFDRDHLLHSARKGIYSTTEDLFLSKAFSDSLGPSKIIPFFYKALGPDQ
SGEINPKDISITTLVTSNRFRVFAKLVENYQGPISATIHVSDSPGILKPLLDSLDELYHS
SKLMSTWVDIHLVVDSFDRQFNMWRNVAKFFARTDYVMMLDVDFWICTDFRQRILGSPEL
IEQLAAGTSAFVIPAFEYTKQSDGVDPDEFPSDKQALMKLVSLGQIGMFHKSWKPGHGST
NYTRFYLADQLDQIYPASGYSHSYEPYVVYKKDKTPFCDERFIGYGANKAACVFELYLSG
VSFYVLPQDFLIHQSHAYAEKTRHHERRFNRKLYSDFREEVCFRYLNEFMNLGIVNEKGH
NMLGECQKIRGFAEAATRLGEANLVPINFRK

Enzyme Prediction     

No EC number prediction in POW22707.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT49	245	527	1.6e-39	0.827893175074184

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404735	Glyco_transf_49	2.06e-54	248	525	1	326	Glycosyl-transferase for dystroglycan. This glycosyl-transferase brings about the glycosylation of the alpha-dystroglycan subunit. Dystroglycan is an integral member of the skeletal muscular dystrophin glycoprotein complex, which links dystrophin to proteins in the extracellular matrix.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR39118.1|GT49	8.18e-159	17	558	2	548
CCA70499.1|GT49	6.18e-134	177	564	59	437
CDS06289.1|GT49	2.31e-129	210	559	83	424
CDS14203.1|GT49	7.23e-129	210	559	85	427
CDS09884.1|GT49	2.47e-128	211	555	53	389

PDB Hits     

POW22707.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6P7A1|LARG2_RAT	9.56e-24	246	497	399	639	Xylosyl- and glucuronyltransferase LARGE2 OS=Rattus norvegicus OX=10116 GN=Large2 PE=2 SV=1
sp|Q5XPT3|LARG2_MOUSE	2.25e-23	238	497	392	639	Xylosyl- and glucuronyltransferase LARGE2 OS=Mus musculus OX=10090 GN=Large2 PE=1 SV=1
sp|Q54PG8|GNT14_DICDI	1.91e-21	249	496	348	584	Glycosyltransferase-like protein gnt14 OS=Dictyostelium discoideum OX=44689 GN=gnt14 PE=2 SV=1
sp|Q21389|LGE1_CAEEL	2.49e-21	238	496	341	592	Glycosyltransferase-like protein LARGE OS=Caenorhabditis elegans OX=6239 GN=lge-1 PE=3 SV=3
sp|Q9Z1M7|LARG1_MOUSE	2.26e-20	248	497	473	709	Xylosyl- and glucuronyltransferase LARGE1 OS=Mus musculus OX=10090 GN=Large1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999984	0.000022

TMHMM  Annotations     

Start	End
42	64