CAZyme Information: POW22150.1

Basic Information

• Species: Puccinia striiformis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia striiformis
• CAZyme ID: POW22150.1
• CAZy Family: GT32
• CAZyme Description: GH131_N domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A2S4WK31]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
343		37229.68	9.7704

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pstriiformis93TX-2	14629	N/A	0	14629

• Gene Location: location=PKSM01000013:428573-430226(-)

Full Sequence      

MLAVKMQCTIFMAIFLFASISLAADPAPGRGGNMGGGTKTPATGAGGGGQASATKRIFDF
KLTPAMKTADLDNPASVLRKMIAYIVKGAGKASEYVSIVPRGTLAPEIKLEIHDDSIFIP
GGNPANAQHGFRRTDVNPVIDKATTLTGVTTWYQTIRLDSKAPLVLTHGYLLSSIEVTVS
DHIFDIFCGSNFDPQNTAHAPTSNSQTIRVRDWATKTLHSLPLKYDQNYNFAVTVDWSAN
TLTVYSSIGTEPLKMVAGPVANDPKAMSPEYKQKGEYHIQLIKFPLADSKVPVAKRLDTP
HFGLQEPIKQEHVFFSNVFATSGKEIEQPKFSASVKSNKPKRM

Enzyme Prediction     

No EC number prediction in POW22150.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH131	59	324	1.4e-33	0.9529411764705882

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408085	GH131_N	1.95e-52	57	319	2	244	Glycoside hydrolase 131 catalytic N-terminal domain. This is the N-terminal domain found in glycoside hydrolase family 131 (GH131A) protein observed in Coprinopsis cinerea. GH131A exhibits bifunctional exo-beta-1,3-/-1,6- and endo-beta-1,4 activity toward beta-glucan. This domain is catalytic in nature though the catalytic mechanism of C. cinerea GH131A is different from that of typical glycosidases that use a pair of carboxylic acid residues as the catalytic residues. In the case of GH131A, Glu98 and His218 may form a catalytic dyad and Glu98 may activate His218 during catalysis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV95300.1|GH131	5.76e-43	53	322	18	296
QRV80910.1|GH131	1.59e-42	53	322	18	296
QRW09714.1|GH131	6.15e-42	53	322	18	296
QRW22550.1|GH131	1.82e-39	51	322	16	294
ALL40783.1|GH131	7.35e-39	57	325	27	297

PDB Hits     

POW22150.1 has no PDB hit.

Swiss-Prot Hits     

POW22150.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000236	0.999772	CS pos: 23-24. Pr: 0.9811

TMHMM  Annotations     

There is no transmembrane helices in POW22150.1.