CAZyme Information: POW21475.1

Basic Information

• Species: Puccinia striiformis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia striiformis
• CAZyme ID: POW21475.1
• CAZy Family: GT20
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
606		68904.94	8.4573

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pstriiformis93TX-2	14629	N/A	0	14629

• Gene Location: location=PKSM01000020:176387-179999(-)

Full Sequence      

YTGSEISGGKITRSGKTANPQYSTPVNIPSIPGRLVTSFPVLISFLTRLCINRDNFDIFT
VRTVAYQVTSAIHPCLRNLLINSFHLYTIHESTWLKFTNHVETSYLAEALGFRAHPLDPP
LYPLWSIFSSSLSLSLSNDGLDATFEKYPVEQWSVQWPPRSANGSWPAPDSSLLRLSDGS
LARLPDEKYGGGVSYSEPDEQDLVPPILHHILLGMDRRRMPKSWTASRNSCLALHPESAN
YTHHFWDDQSAEDFMRKHYSFFLRDFLDYRHNIQRADSLRYFVLHHYGGIFLDMDLECRR
SLGPLRRFPIVNINASPAGVSNGFMMAQAKHPFTEQLIKSLKYYDLSWLGVPYFDIMLST
GPMFLSTEHLRFPASQRPTQLRVLGGREHRLKGRVVTPLFRHLGASSWHQGDAKLFIKVL
AIVYQPFFSLLLLCGFVGGSVGWLVWKKQISKQGDDRWSQSSQGSEARRFSAGRLVLWRF
GFGSRRSRRRTDDEYERIEMDLESPTGLMCTRRLTPILEDDEDLETKSNPETEHKKSILN
LGRKRSAYNTLKSPSTPNIFRGEHEDFCHGGNGSCPSTSSDSEDDGSSADAVVVLIDRHS
SKWRDS

Enzyme Prediction     

No EC number prediction in POW21475.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	224	305	1.8e-18	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.67e-27	191	461	69	347	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.24e-13	221	305	1	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFN02868.1|GT32	1.50e-156	146	545	1	420
UJR26144.1|GT32	1.29e-65	122	425	49	302
VBB86275.1|GT32	1.08e-57	89	419	38	331
ANH56537.1|GT32	3.15e-57	106	453	26	324
UNI15446.1|GT32	1.67e-56	202	419	87	296

PDB Hits     

POW21475.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38287|CSH1_YEAST	4.96e-42	170	420	25	270	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	1.40e-40	198	415	49	258	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|O14084|IMT1_SCHPO	1.19e-35	196	434	56	294	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|Q10323|IMT3_SCHPO	3.57e-32	204	458	57	318	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	1.20e-30	130	417	20	290	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999755	0.000257

TMHMM  Annotations     

Start	End
424	446