CAZyme Information: POW21412.1

Basic Information

• Species: Puccinia striiformis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia striiformis
• CAZyme ID: POW21412.1
• CAZy Family: GT2
• CAZyme Description: Beta-galactosidase [Source:UniProtKB/TrEMBL;Acc:A0A2S4WI29]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1058		118730.38	5.7295

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pstriiformis93TX-2	14629	N/A	0	14629

• Gene Location: location=PKSM01000021:14262-19219(-)

Full Sequence      

MKLRFHSLLTLSLGVVQTQFRIAAPPSLGASDSESPSVVSWDRHSMLIEGERVFIQSGEF
HTWRLPVVSQWTDILQKFSAAGLNTVSIYGKKRSELTIDHGWAVTVAGGIPGWVTTLACP
LRTKATDFDRSWRQYWDEMIDRIVPNQIGLPNGTVIAVQVENEYLTDAHSFQGQPPGKDQ
YMQDLADALLDKGIVVPLTVNDAGMDRNFATGMGAMDICQIILLANPKKTCQHFPFADEM
IYQLIDGFDSYPQSFDCSKPNQWKPVVETYKKFQAGAYDSWGATGYENCRKLTGPEFESV
FYLNNLAANIKMINYYMLYGGTNWGQLAFPGTYTSYDYGSAISEDRTLNEKYTELKRQSL
FLRSSKEFYETEVVGDSKHDPNYFEAGDKNSAVVTELRNPTSGAGFYIVRALNSTSIKPT
NFTLNVLTSVGLKQLPQITLLPRESRLLVTDYRTSPKSDGPGVPHPIQLLYTTSSVLLSA
HIGGHQVLTCFRIASGDAETSSIKIPDLERGYFTKSFPETGQPPSFQISAGDDSHGYREI
NWRVRDEGSIFALGSQSSVVLITSKAMAGEVWNPILAQSDPSKPSSSVLIWGPWLVRNAS
ISITDNTQRKILRIWGDFEEGSKKEVLIFVGGLSIGEVEWNGKTVENLARAPESSFLSFI
YHPNSFKTYMQNKSNNQLTHVGSRIDFRTLKWRYQDSLPEIKTGFSDDQWTEATIEKSNN
HYKKLYGKYYLYACDYGFCNGATIWRGHFLQKCQSSFQDQHEAHPNAQVDSPMGINLTIA
GGDFFAASVWLNDIFLGSVPNVLSKSNPKSYSKTHMKTFHFPPGSLQECEANIITVVQDS
MGMDQTEDGFSDTVKHPRGILGYKFEGQSVESSFEEISWKVQGHLGGFYNLPDPERGIYN
ENGFYGMRSGWHLPDYVDEPDNLNWEKLSPIEDGLKTAGIGFYSTTLNLDFEQGYDVIVS
FQFQQPSVDEGRYRVEFWINGWHMGKFVSHLGPQTRFPVHQGILNYQADNHIALTLWALD
DEGAKISGLELVVDKILEGGIGPIENHHPPYDSSRRHL

Enzyme Prediction     

EC	3.2.1.23:18	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	106	357	4.2e-38	0.6905537459283387

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396048	Glyco_hydro_35	6.38e-45	45	357	1	313	Glycosyl hydrolases family 35.
404274	BetaGal_dom4_5	1.90e-31	905	1022	1	111	Beta-galactosidase jelly roll domain. This domain is found in beta galactosidase enzymes. It has a jelly roll fold.
402180	BetaGal_dom2	8.45e-19	390	488	16	109	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyzes the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C-terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N-terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, pfam01301, which is N-terminal to it, but itself has no metazoan members.
404274	BetaGal_dom4_5	1.10e-16	731	844	23	111	Beta-galactosidase jelly roll domain. This domain is found in beta galactosidase enzymes. It has a jelly roll fold.
198097	BetaGal_dom2	5.10e-14	390	566	17	178	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyses the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, which is N-terminal to it, but itself has no metazoan members.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW00634.1|GH35	4.72e-189	29	1053	31	1003
QRW10069.1|GH35	2.41e-188	38	1040	67	1072
QRV86584.1|GH35	7.87e-187	25	1053	27	1003
QRW27580.1|GH35	2.07e-186	24	1053	24	1001
QRW15140.1|GH35	6.09e-186	25	1053	27	1003

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1TG7_A	5.48e-133	39	1056	6	968	Native structure of beta-galactosidase from Penicillium sp. [Penicillium sp.],1XC6_A Native Structure Of Beta-Galactosidase from Penicillium sp. in complex with Galactose [Penicillium sp.]
5IFP_A	7.47e-133	39	1056	46	1004	Structure Of Beta-galactosidase From Aspergillus Niger [Aspergillus niger CBS 513.88]
5IFT_A	7.47e-133	39	1056	46	1004	STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 3-b-Galactopyranosyl glucose [Aspergillus niger CBS 513.88],5IHR_A Structure Of E298q-beta-galactosidase From Aspergillus Niger In Complex With Allolactose [Aspergillus niger CBS 513.88],5JUV_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-b-Galactopyranosyl galactose [Aspergillus niger CBS 513.88],5MGC_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 4-Galactosyl-lactose [Aspergillus niger CBS 513.88],5MGD_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-Galactosyl-lactose [Aspergillus niger CBS 513.88]
3OG2_A	3.21e-131	25	1031	10	975	Chain A, Beta-galactosidase [Trichoderma reesei],3OGR_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGS_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGV_A Chain A, Beta-galactosidase [Trichoderma reesei]
4IUG_A	9.64e-128	38	1056	45	1002	Crystal structure of beta-galactosidase from Aspergillus oryzae in complex with galactose [Aspergillus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DJ58|BGALE_NEOFI	5.99e-138	38	1055	41	1008	Probable beta-galactosidase E OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=lacE PE=3 SV=1
sp|B0XXE7|BGALE_ASPFC	4.58e-136	20	1055	15	1008	Probable beta-galactosidase E OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=lacE PE=3 SV=1
sp|Q4WG05|BGALE_ASPFU	4.58e-136	20	1055	15	1008	Probable beta-galactosidase E OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=lacE PE=3 SV=1
sp|A2QAN3|BGALA_ASPNC	3.35e-132	39	1056	46	1004	Beta-galactosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=lacA PE=1 SV=1
sp|Q700S9|BGALA_PENSQ	7.14e-132	39	1056	46	1008	Beta-galactosidase A OS=Penicillium sp. OX=5081 GN=lacA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.009941	0.990040	CS pos: 23-24. Pr: 0.9397

TMHMM  Annotations     

There is no transmembrane helices in POW21412.1.