CAZyme Information: POW19955.1

Basic Information

• Species: Puccinia striiformis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia striiformis
• CAZyme ID: POW19955.1
• CAZy Family: GH76
• CAZyme Description: Chitobiosyldiphosphodolichol beta-mannosyltransferase [Source:UniProtKB/TrEMBL;Acc:A0A2S4WDU4]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
514		58436.31	9.3402

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pstriiformis93TX-2	14629	N/A	0	14629

• Gene Location: location=PKSM01000040:85663-88114(-)

Full Sequence      

MRWLLGRHRTTMLSLALALVLISTLTLFHRLHGRKSIARKESIAIVVLGDIGRSPRMMRH
ALSFADQQWYVSIFAYKGSKPPNSLLQNPNIRLVNLPEFPDRITSFCQEFYSRSAGLLWT
LLSNSNKFSYIMVQNPPAIPTLPIVQLVRLLLGSKLIIDWHNTAYSILALKFGSDRHPMV
VSPNGTCVSIQYTASPYKRRETRMTEAKFGKNATLHLFVTEAEKQALSEMWHLRGLKKVF
YDRPPKSFCRLTVPEIHSFFRQSSFNYDSFLQKMFVQSGSSLHQESLLTYADQEAKITKM
KSDRPALIVSSTSWTIDEDFTKRWRCIPDQKRKIVKGAESLPKLMCLITGKGPLKEYYLE
IISKKSKEEGWEDVGIVCQSVWFDDPEDYRKILGAADLGISLHQSSSGLDLPMKVVDMFG
CGLPVCARNFNCISELVKHGQNGLVFDSAIELSGQLEELLSGFNSEPVGNELSSSTNYSP
TLRVNPPDDKGANRSWSSWEDEWNQRVFQTFQTL

Enzyme Prediction     

EC	2.4.1.142:10	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT33	41	507	6.2e-124	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340843	GT33_ALG1-like	1.24e-147	40	507	3	407	chitobiosyldiphosphodolichol beta-mannosyltransferase and similar proteins. This family is most closely related to the GT33 family of glycosyltransferases. The yeast gene ALG1 has been shown to function as a mannosyltransferase that catalyzes the formation of dolichol pyrophosphate (Dol-PP)-GlcNAc2Man from GDP-Man and Dol-PP-Glc-NAc2, and participates in the formation of the lipid-linked precursor oligosaccharide for N-glycosylation. In humans ALG1 has been associated with the congenital disorders of glycosylation (CDG) designated as subtype CDG-Ik.
215155	PLN02275	9.50e-112	37	460	1	371	transferase, transferring glycosyl groups
340816	Glycosyltransferase_GTB-type	6.54e-07	338	446	136	235	glycosyltransferase family 1 and related proteins with GTB topology. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
395425	Glycos_transf_1	1.42e-06	339	461	29	143	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
223515	RfaB	2.08e-06	339	461	226	341	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CED84249.1|GT33	7.95e-99	41	507	47	508
CDR45157.1|GT33	5.87e-94	22	507	15	492
CCA73277.1|GT33	6.77e-94	13	505	13	505
NP_663337.2|GT33	2.28e-92	12	469	8	432
BAE26713.1|GT33	2.28e-92	12	469	8	432

PDB Hits     

POW19955.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q921Q3|ALG1_MOUSE	4.05e-93	12	469	8	432	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Mus musculus OX=10090 GN=Alg1 PE=1 SV=3
sp|Q5R7A2|ALG1_PONAB	1.27e-89	43	507	35	457	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Pongo abelii OX=9601 GN=ALG1 PE=2 SV=1
sp|Q9BT22|ALG1_HUMAN	1.40e-88	34	507	27	457	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Homo sapiens OX=9606 GN=ALG1 PE=1 SV=2
sp|Q8L7M0|TUN_ARATH	2.53e-73	39	463	3	420	UDP-glycosyltransferase TURAN OS=Arabidopsis thaliana OX=3702 GN=TUN PE=2 SV=1
sp|P90522|ALG1_DICDI	8.26e-71	43	503	4	455	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Dictyostelium discoideum OX=44689 GN=alg1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999731	0.000311

TMHMM  Annotations     

Start	End
12	29