CAZyme Information: POW19348.1

Basic Information

• Species: Puccinia striiformis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia striiformis
• CAZyme ID: POW19348.1
• CAZy Family: GH63
• CAZyme Description: Chitinase [Source:UniProtKB/TrEMBL;Acc:A0A2S4WC67]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
493		53727.79	7.7284

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pstriiformis93TX-2	14629	N/A	0	14629

• Gene Location: location=PKSM01000050:127917-130317(+)

Full Sequence      

MGAGTICDLVGPYRDTNRDKFGSATVGSDPSTHTGMAFMDEDMKRVRFSVNSFLVSIPSH
PPVPTPCLFAFSCTCCFYRPPPSQKMRSSSQAYSATFLLATLLFGTNPNACVVNPPNSAK
VKGYYPTYNSAGQPVSTIDWAAYTDVLFFMVIPQANNTLSFDPSLTPDQGEKLVKEQSQS
SLQYGWLDGVATIFKLDLNGCFSQTLCQTTRRFWEEKRVHWNRNGLGIEGIGCNSRNPAD
VVNFGLFAKELRSLWPEASLTAALGLSGLIGPDGKPATTKETALLNQHLDFVNLMAYDVY
GPWAPTTGPLAPLHATCAPPAFAQSVETGLQVALKQGFKASQVILGIPGYAKRLELLSNK
LEPKTVNGTTTFYYQNHTTITPPGGTFDDKPGNDICGNHTNWGGSFLVTELIRNGWLSAD
QKTGLNGYQRHFDKCSGQPFLSNGQFFISYDDQESTVAKAKFAKENKLGGIYFFDTMGPT
SATVRAARQVMSS

Enzyme Prediction     

No EC number prediction in POW19348.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	224	475	1.7e-30	0.6182432432432432

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395573	Glyco_hydro_18	1.21e-29	123	475	4	303	Glycosyl hydrolases family 18.
214753	Glyco_18	1.88e-29	238	475	122	330	Glyco_18 domain.
225862	ChiA	4.92e-28	227	487	179	431	Chitinase, GH18 family [Carbohydrate transport and metabolism].
119365	GH18_chitinase	1.54e-26	227	473	137	316	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
119351	GH18_chitolectin_chitotriosidase	1.29e-24	232	471	124	333	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAP42832.1|GH18	4.99e-177	86	493	1	420
ALL41259.1|GH18	5.51e-66	295	491	1	198
CDR43393.1|GH18	1.78e-46	124	493	29	407
CRX79101.1|GH18	3.45e-43	230	472	94	336
AEH16745.1|GH18|3.2.1.14	8.69e-40	116	488	39	395

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GZU_A	9.33e-15	219	475	155	373	Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZU_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_A Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]
5GZT_B	1.03e-14	219	475	406	624	Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]
1OGB_A	1.31e-13	227	474	135	403	Chitinase b from Serratia marcescens mutant D142N [Serratia marcescens],1OGB_B Chitinase b from Serratia marcescens mutant D142N [Serratia marcescens],1OGG_A chitinase b from serratia marcescens mutant d142n in complex with inhibitor allosamidin [Serratia marcescens],1OGG_B chitinase b from serratia marcescens mutant d142n in complex with inhibitor allosamidin [Serratia marcescens]
1UR9_A	1.31e-13	227	474	135	403	Interactions of a family 18 chitinase with the designed inhibitor HM508, and its degradation product, chitobiono-delta-lactone [Serratia marcescens],1UR9_B Interactions of a family 18 chitinase with the designed inhibitor HM508, and its degradation product, chitobiono-delta-lactone [Serratia marcescens]
1ITX_A	1.77e-13	230	485	178	412	Chain A, Glycosyl Hydrolase [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P20533|CHIA1_NIACI	1.61e-12	230	485	210	444	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
sp|P11797|CHIB_SERMA	3.69e-12	227	474	135	403	Chitinase B OS=Serratia marcescens OX=615 GN=chiB PE=1 SV=1
sp|Q9WTV1|CH3L1_RAT	7.50e-12	185	470	96	346	Chitinase-3-like protein 1 OS=Rattus norvegicus OX=10116 GN=Chi3l1 PE=2 SV=3
sp|Q61362|CH3L1_MOUSE	7.82e-12	247	470	170	357	Chitinase-3-like protein 1 OS=Mus musculus OX=10090 GN=Chi3l1 PE=1 SV=3
sp|P36222|CH3L1_HUMAN	7.54e-11	247	470	161	348	Chitinase-3-like protein 1 OS=Homo sapiens OX=9606 GN=CHI3L1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999850	0.000173

TMHMM  Annotations     

There is no transmembrane helices in POW19348.1.