CAZyme Information: POW19170.1

Basic Information

• Species: Puccinia striiformis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia striiformis
• CAZyme ID: POW19170.1
• CAZy Family: GH5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
599		67293.93	7.6133

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pstriiformis93TX-2	14629	N/A	0	14629

• Gene Location: location=PKSM01000053:291546-294237(+)

Full Sequence      

KNTYSTRFIQQKNNNNGHGFEHDEIDCNPTLLVNSLGLGEPPDGKAYLGAWTDGSAPYYD
TPSAFNSRIGQNTFAFQLAQTIPITPYNYTSGSGGAINITEITKTNTPASIYLTVYPQSL
ERVTDQDLTILATQISSYFISMPERKVFLRFAPEMQGQWMKYGAQPSLFILTWKKMYSIV
KNLAPQTIIVWAPNGAMGYPFGIKLKDVISKADQDLLDTNKNGELDSNDDAYGAYYPGDG
YVDWNGISWYWKGNEYPYKVNQILPTGYSAGAMTGKSPPGSIGSSNSVEPQNFTNFYDTY
CQNNHASAYHNNDNGTTTINQLSLQQAWWRDCLTSISFMNNFPKIKMFMVFEHQKFEDQN
DLRDYRITVDGNVRNSWLDDFKAVQDRFIWADNITLQSDGSSPAKKKASKGARKMTTFHA
GLSNNASSNLCFLNSVIQALASTQEYTKYLKEIHSEKPKGEGSKPSIIEELLPIIEELNT
PRNRNIVLRPTKLIEALLANHATGLAALLLPTITNQPRTQRNPFRGLMANRIACAACAFL
AGIHHSPTNHLSISLPFCATCTLEDCLKEYTILELLDDYFCRKCTLIKRNHVKKSNQWH

Enzyme Prediction     

No EC number prediction in POW19170.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	113	282	3.6e-17	0.44884488448844884

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
239127	Peptidase_C19F	1.19e-20	421	589	1	125	A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
395355	UCH	1.39e-13	420	594	1	199	Ubiquitin carboxyl-terminal hydrolase.
239133	Peptidase_C19L	8.64e-10	421	584	1	182	A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
239139	Peptidase_C19R	1.10e-05	421	590	1	113	A subfamily of peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR47404.1|GH0	9.33e-92	33	412	33	415
AGT80089.1|GH0	8.35e-61	45	391	35	382
ALL40968.1|GH26	9.00e-48	176	391	1	214
APV45119.1|GH26	2.49e-33	29	381	38	381
QOL36364.1|GH26	9.10e-30	147	380	168	402

PDB Hits     

POW19170.1 has no PDB hit.

Swiss-Prot Hits     

POW19170.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000043	0.000008

TMHMM  Annotations     

There is no transmembrane helices in POW19170.1.