CAZyme Information: POW17477.1

Basic Information

• Species: Puccinia striiformis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia striiformis
• CAZyme ID: POW17477.1
• CAZy Family: GH47
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
2237		248612.48	7.6145

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pstriiformis93TX-2	14629	N/A	0	14629

• Gene Location: location=PKSM01000074:33382-43495(-)

Full Sequence      

TTKAIDCCSLMSANNSSQARRKRPSNGTNYFKMSPSGITSPILLFLFHYSLVIINASPLI
YSHNPLAASAHPREYILSPHFDINEERITRTYTFNVTETTAALDGFLRPVLAINGQVPGP
LIEANEGDQLEITVINHMKVGLTLHWHGLYQASAESFASTYPLILSHHQNLMADGINGPL
IIHSPRDPLKRHTDFDQEVVLVLADWYHNTSTDIVEHMLSEPGYFGTPAAPGPNSALING
IGEWNCSQATKSEQCKQINSPPEFTFEAGGKIRFRLINAGVHAMFFYSVDEHTLNVTEAD
GTGIYGPPALHRVWLHNGQRYSVVINTREEDAGRSFYLRATMDSDCFHNLNIRSMSLPIS
IASPSNLRRVPNDIQLTAFGILRLVDGGYNAKKVSHSRPVTQDWSDEILGDCVDLPTSSM
VPILKQSVPTSVVGSGSFKAGFGFQFINDTSEHVSRAEAVQLAQQVNSTSLLLTTNPRTE
DLNETSDTSNYLRNDTGRTLLAERIHPARGLSKAQSQPEYPQTAYNKRQVKVGQHNLPSG
NRTNQLGITRTGGPPPTPAGTIGKFFLNNISWTTYPYQPILHDLTPGGVGAVNDSNVANV
IYPTAEWYDLYLANVDPAGSHPYHLHALDMHIVAEGKGLPTPQNLANATYNTDNPLRRYD
RCATRVIHSRPPSSRRTWCLDRRFAGVVIVQPDVIKNFEIPQDNLDLCAARSSEGHICDR
SLILCEIPLQIEYKWLAWSYGSPPIECDFTAYSNLEEDMSSSTGGKPKKRAHIVRSGNAG
NSSKSAAPTPPTEPGKDKPPPLFPPGSKTPVQLLHERCRHNKWEKPSVDIKRSSGGFTAV
VTLVKKDKKDASLRHTVRMEPRPPLDRTTGEEAKHWAATYALFRFCNNMPLHRVLPPGPK
DYWVNLEQEKRTAPAHRDWEFDPDPFQAAVEVKKRQQVREQNIEQSTSTHEGGSRGEEKK
SLPKCWSLAPEVKMDHVLRDRSEQIIRGLLARIQVPDSESTSQDAHPSIHSNPQLSPSES
KKLSDELIKMGFRPGHVSSALDHLSKIRNTSESATNDKTSQLARTLLKSFQGSSDRDALL
QYLTVVVPEDDLPIRFRPTEKSTSFVTAMSSGAGRGPNGQELEIRWMVERLNRLHGFPLE
AISTTLNGPVGPRESVALETLARRLAGSDVDSPMKHADIASQETPEIKELLQSRDQKRAM
EKEALESIYGVDRYQIVPEKPETDFQISIVAQPQAREDLWLRISFHPDSLYPTATSLIST
ACIPTFSIISSTVPSYLRLALLKKTIEQFADPNNGWCSMLDVGEGGVIFEMVNYLEETWP
LLAQEPPDVADVMYNFVVEKQSPQSASTSSSSPSIKPRGTPKQQSRVLALRQIPETDHRL
MKEQCALIANPAYKSVLKDRQSLPAWSSRADFLKALSDPTTRVIVVAGETGSGKTTQLPQ
FILESECEAGRGSLVNIICTQPRRVSAIGVATRVASERLENIDEKDGVVGYVIRGEKRSG
RHTKLLFATSGVLLRRLATSDPDLLGISHLFVDEVHERSMEGDLLLLELREILKRNLKIK
IVLMSATANQDLFVNYFGTATRINIPGMTYPVKDFYLEDYLKRLEYTPVNSKSRPERDAK
ERKQAEELCKKFMAMGHKESESRFLASASKAVRYIDEHLIASIVLNILDGSTSEQGDGSL
GVVLVFVSGVAEICSAIKAIENLCRKRVECLPLHSQLSSAEQKRVFRPTHPSRMKVVVAT
NIAETSITIPDVRYVIDSGREKQMELDPEVGMSRLVEVNCSQAAAKQRRGRAGRTISGVA
YKLFTRICEQQTMLVDTKPEILRTPLEALFLQVKAIREKEDVPTYLQKALTPPLQSAVDR
AIENLEVVGAFYDGSLTALGKHLAQLPLDVRLGKLLILGSIFKVFEPTLTLAAMLSVNKP
LFVTPFEKREESSQARLKFKVANSDLLTNIKAFDEYVRIQRESGNGSAREFCETNYLSMS
TIRDIISTRSDLLSQMQERGFVPRSYGKNNLNRLALVTPNAGDHADELNLNQNSEKLNLV
KSVFAAGLSQVVRIEVPETKYDQIASGTIEKDVDSKAVKFFDAKIGRVFLHPSSVLFKSA
QELKATFLAYFSRSASGSDTNAKVFLRDGTTVPLFGMLLLYGSGSIKLNHERRGLSIQTR
SSEQDGRETNESSIKLRAPMRIGTLCNQLRHLLDTLLFMVVDQPEKIVNHWQNDTDAQQV
IECVINLIESDGVACAI

Enzyme Prediction     

No EC number prediction in POW17477.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA1	98	351	1.2e-49	0.7067039106145251

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224557	HrpA	2.40e-142	1370	2095	7	657	HrpA-like RNA helicase [Translation, ribosomal structure and biogenesis].
259950	CuRO_2_Diphenol_Ox	9.23e-86	199	385	1	164	The second cupredoxin domain of fungal laccase, diphenol oxidase. Diphenol oxidase belongs to the laccase family. It catalyzes the initial steps in melanin biosynthesis from diphenols. Melanin is one of the virulence factors of infectious fungi. In the pathogenesis of C. neoformans, melanin pigments have been shown to protect the fungal cells from oxidative and microbicidal activities of host defense systems. Laccase is a blue multi-copper enzyme that catalyzes the oxidation of a variety aromatic - notably phenolic and inorganic substances coupled to the reduction of molecular oxygen to water. It has been implicated in a wide spectrum of biological activities and, in particular, plays a key role in morphogenesis, development and lignin metabolism. Laccase is a multicopper oxidase (MCO) composed of three cupredoxin domains that include one mononuclear and one trinuclear copper center. The copper ions are bound in several sites: Type 1, Type 2, and/or Type 3. The ensemble of types 2 and 3 copper is called a trinuclear cluster. MCOs oxidize their substrate by accepting electrons at a mononuclear copper center and transferring them to the active site trinuclear copper center. The cupredoxin domain 2 of 3-domain MCOs has lost the ability to bind copper.
182986	PRK11131	3.14e-71	1401	1984	71	589	ATP-dependent RNA helicase HrpA; Provisional
350675	DEXHc_RHA-like	3.27e-64	1422	1585	2	159	DEXH-box helicase domain of DEAD-like helicase RHA family proteins. The RNA helicase A (RHA) family includes RHA, also called DEAH-box helicase 9 (DHX9), DHX8, DHX15-16, DHX32-38, and many others. The RHA family belongs to the DEAD-like helicase superfamily, a diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region.
350178	SF2_C_RHA	1.08e-56	1639	1804	9	171	C-terminal helicase domain of the RNA helicase A (RHA) family helicases. The RNA helicase A (RHA) family includes RHA, also called DEAH-box helicase 9 (DHX9), DHX8, DHX15-16, DHX32-38, and many others. The RHA family members are DEAD-like helicases belonging to superfamily (SF)2, a diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. Similar to SF1 helicases, SF2 helicases do not form toroidal structures like SF3-6 helicases. Their helicase core consists of two similar protein domains that resemble the fold of the recombination protein RecA. This model describes the C-terminal domain, also called HelicC.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV98945.1|AA1	5.10e-106	72	709	50	592
QRW13493.1|AA1	9.15e-104	72	709	50	592
QRV91744.1|AA1	3.04e-99	81	709	39	560
QRV76916.1|AA1	3.04e-99	81	709	39	560
QRW05810.1|AA1	7.39e-97	81	709	39	560

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6UP2_A	6.89e-107	1377	2230	22	830	Crystal structure of the murine DHX36 helicase [Mus musculus],6UP3_A Crystal structure of the murine DHX36 helicase in complex with ANP [Mus musculus],6UP4_A Crystal structure of the murine DHX36 helicase in complex with ADP [Mus musculus]
5VHA_A	3.20e-106	1377	2230	34	842	DHX36 with an N-terminal truncation [Bos taurus],5VHC_D DHX36 with an N-terminal truncation bound to ADP-BeF3 [Bos taurus],5VHD_D DHX36 with an N-terminal truncation bound to ADP-AlF4 [Bos taurus]
5VHE_A	9.50e-106	1377	2230	97	905	DHX36 in complex with the c-Myc G-quadruplex [Bos taurus]
5N8R_A	6.74e-92	1374	2144	124	855	Crystal Structure of Drosophilia DHX36 helicase in complex with GAGCACTGC [Drosophila melanogaster],5N8R_B Crystal Structure of Drosophilia DHX36 helicase in complex with GAGCACTGC [Drosophila melanogaster],5N8S_A Crystal Structure of Drosophila DHX36 helicase in complex with polyT [Drosophila melanogaster],5N8S_B Crystal Structure of Drosophila DHX36 helicase in complex with polyT [Drosophila melanogaster],5N8U_A Crystal Structure of Drosophila DHX36 helicase in complex with CTCTCCT [Drosophila melanogaster],5N8U_B Crystal Structure of Drosophila DHX36 helicase in complex with CTCTCCT [Drosophila melanogaster],5N8Z_A Crystal Structure of Drosophila DHX36 helicase in complex with CTCTCCCTT [Drosophila melanogaster],5N8Z_B Crystal Structure of Drosophila DHX36 helicase in complex with CTCTCCCTT [Drosophila melanogaster],5N90_A Crystal Structure of Drosophila DHX36 helicase in complex with TTGTGGTGT [Drosophila melanogaster],5N90_B Crystal Structure of Drosophila DHX36 helicase in complex with TTGTGGTGT [Drosophila melanogaster],5N94_A Crystal Structure of Drosophila DHX36 helicase in complex with polyU [Drosophila melanogaster],5N94_B Crystal Structure of Drosophila DHX36 helicase in complex with polyU [Drosophila melanogaster],5N96_A Crystal Structure of Drosophila DHX36 helicase in complex with AGGGTTTTTT [Drosophila melanogaster],5N96_B Crystal Structure of Drosophila DHX36 helicase in complex with AGGGTTTTTT [Drosophila melanogaster],5N98_A Crystal Structure of Drosophila DHX36 helicase in complex with TAGGGTTTT [Drosophila melanogaster],5N98_B Crystal Structure of Drosophila DHX36 helicase in complex with TAGGGTTTT [Drosophila melanogaster],5N9A_A Crystal Structure of Drosophila DHX36 helicase in complex with GTTAGGGTT [Drosophila melanogaster],5N9A_B Crystal Structure of Drosophila DHX36 helicase in complex with GTTAGGGTT [Drosophila melanogaster],5N9D_A Crystal Structure of Drosophila DHX36 helicase in complex with GGGTTAGGGT [Drosophila melanogaster],5N9D_B Crystal Structure of Drosophila DHX36 helicase in complex with GGGTTAGGGT [Drosophila melanogaster],5N9E_A Crystal Structure of Drosophila DHX36 helicase in complex with TGGGGATTT [Drosophila melanogaster],5N9E_B Crystal Structure of Drosophila DHX36 helicase in complex with TGGGGATTT [Drosophila melanogaster],5N9F_A Crystal Structure of Drosophila DHX36 helicase in complex with ssDNA CpG_A [Drosophila melanogaster],5N9F_B Crystal Structure of Drosophila DHX36 helicase in complex with ssDNA CpG_A [Drosophila melanogaster]
5AOR_A	1.33e-77	1393	2001	374	976	Structure of MLE RNA ADP AlF4 complex [Drosophila melanogaster],5AOR_B Structure of MLE RNA ADP AlF4 complex [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0C7L7|YUM14_USTMA	0.0	802	2234	89	1566	Putative DEAH-box ATP-dependent helicase UM11114 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=UMAG_11114 PE=3 SV=1
sp|O94536|UCP12_SCHPO	8.74e-146	808	2233	66	1327	Putative ATP-dependent RNA helicase ucp12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ucp12 PE=3 SV=1
sp|F4ILR7|DEXH1_ARATH	2.36e-119	1380	2230	205	992	DExH-box ATP-dependent RNA helicase DExH1 OS=Arabidopsis thaliana OX=3702 GN=At2g35920 PE=2 SV=1
sp|Q06698|YL419_YEAST	4.08e-118	808	2231	61	1434	Putative ATP-dependent RNA helicase YLR419W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YLR419W PE=1 SV=1
sp|Q6P5D3|DHX57_MOUSE	4.70e-113	1389	2152	531	1321	Putative ATP-dependent RNA helicase DHX57 OS=Mus musculus OX=10090 GN=Dhx57 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998739	0.001255

TMHMM  Annotations     

Start	End
30	52